(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE349

CP002209.PE349       Location/Qualifiers
FT   CDS_pept        383576..384322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0349"
FT                   /product="cell division protein FtsQ"
FT                   /note="COGs: COG1589 Cell division septal protein; InterPro
FT                   IPR013685: IPR005548; KEGG: sse:Ssed_0412
FT                   polypeptide-transport-associated domain-containing protein;
FT                   PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   SPTR: A2UXR2 Polypeptide-transport-associated, FtsQ-type;
FT                   PFAM: Cell division protein FtsQ; POTRA domain, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74563"
FT                   /db_xref="GOA:E1SN64"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN64"
FT                   /protein_id="ADN74563.1"
FT                   /translation="MVLAQWREIRWSLWLGLTFLFLVLIGLVQGGLWLKAFATSADQLP
FT                   IEEVALMGERRFTADQEVRDALHNLETWSLFTADVGQIRDALDDLPWVDRVTVRREWPN
FT                   RLRVFLVEQQPVAHWDGEGWLNDRAEPFQAPVRPGLDALPELRGPQGSASKVWQMWQQV
FT                   SELLALNGHTGHSLSLSGRHAWQLVLDNGIALELGRKDTLARVQRFIDVWPELQRDGRV
FT                   PERVDLRYDTGLAVRWQQNEQEKQKG"
     atggtgctgg cgcaatggcg tgagattcgg tggagcctgt ggctggggct caccttcctg        60
     tttctggtcc tgattggact ggtgcagggc gggctctggc tcaaggcctt tgccaccagc       120
     gccgatcagc tgccgatcga agaggtcgcg ctgatgggcg aacggcgctt taccgccgac       180
     caggaggtgc gggatgccct gcacaacctg gagacctgga gtctgtttac cgccgatgtg       240
     gggcagatcc gggacgcgtt ggacgacctg ccctgggtag accgggtcac cgtccgacgc       300
     gaatggccca accgcctgcg ggtgttcctg gtggagcagc agccggtggc gcactgggac       360
     ggcgaaggct ggttgaatga ccgggccgaa ccgttccagg ccccagtcag acctgggctg       420
     gatgccctgc cggaactgcg agggccccag ggcagcgcaa gcaaggtttg gcagatgtgg       480
     cagcaagtgt ctgaattgct ggcattgaat ggccacactg ggcactcttt gagtctcagc       540
     gggcgccacg cctggcaact ggtgctggat aacggcatcg cccttgaact gggcagaaaa       600
     gataccctgg cccgggtgca gcgttttatc gacgtctggc ccgagctaca gcgtgacggc       660
     cgagtgccgg aacgggtgga cttacgatac gacacgggat tggccgtgcg ttggcagcaa       720
     aacgagcaag agaagcagaa gggatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page