(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE353

CP002209.PE353       Location/Qualifiers
FT   CDS_pept        complement(387807..388238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0353"
FT                   /product="protein of unknown function DUF721"
FT                   /note="COGs: COG4701 conserved hypothetical protein;
FT                   InterPro IPR007922; KEGG: sdn:Sden_0361 hypothetical
FT                   protein; PFAM: protein of unknown function DUF721; SPTR:
FT                   A2V4N0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74567"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN68"
FT                   /protein_id="ADN74567.1"
FT                   /translation="MLMGQRFAQIQDKSGTLAQLHQHLLAALDPAVRPHCAVSNLRGGV
FT                   LVIGVSSAAWATRLQYQRLELLSELRGKGFPMLTSIEFKVNPQLSRLQAEKPTNTNRLS
FT                   DKASEHLQQLAENIGGELGEKLKRLAAQAGRPDKGSKSD"
     atgttgatgg gccagcgttt tgcgcagatc caggataagt ccggcacatt ggcccagtta        60
     caccagcatc tgctggcagc gttggatccg gcagtgcgtc cgcactgtgc ggtgtccaat       120
     ctgcgcggcg gcgttctggt gattggcgtg agctcggcag cctgggcaac ccggttgcag       180
     taccagcgtc tggaactgct gtcagagctg aggggcaagg ggtttcccat gctcaccagt       240
     atcgagttta aagtcaaccc gcagctgtcc cgcctccagg cggagaagcc caccaatacc       300
     aaccgcttaa gcgacaaagc gagcgagcac ttacaacagc tggcagagaa tataggcggc       360
     gaattgggag agaagctgaa acgactggcc gcccaagcag ggcggccaga taaaggatca       420
     aagtccgatt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page