(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE354

CP002209.PE354       Location/Qualifiers
FT   CDS_pept        388297..389202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0354"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   slo:Shew_3446 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   A2V4N1 Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74568"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN69"
FT                   /protein_id="ADN74568.1"
FT                   /translation="MSVTVFIRGKHGVRRIEPGKRWLLAPLMLVAAGATLWWQARENVS
FT                   TVEHQLAAASASTEHHQNEIAALRDRTEAQLSLLAARLGRMQARMNRIESLGIAVADRV
FT                   ELSDQFDFQSEVGLGSSGVEPSEQVELSLLLEEMDQMMLRLERADDQLALLETLERHHH
FT                   IDEDTYLSGRPLSKGWQSSSFGYRNDPFNGRRTLHRGLDFAGPEGGEVIATGAGVVSYS
FT                   GTMFGYGNLVEIDHGNGVKTRYGHNKENLVELGQVVAKGETVALIGNTGRSTGPHVHYE
FT                   VMLNDQQVDPARYVYRKPRT"
     atgagtgtaa cagtctttat tcgtggaaag cacggtgtac gccgtatcga acccggcaaa        60
     cgttggttgc tggcgccgtt gatgctggtg gcagccggtg caaccttgtg gtggcaggca       120
     agggaaaacg tctccaccgt ggaacaccag ttggcggccg cttcggcctc cacggaacat       180
     catcagaatg agatcgccgc gctgcgcgat cgcaccgagg cccagctctc cttgctggcg       240
     gctcggcttg gtcgcatgca ggcccgcatg aaccgcatcg aatctctggg gatcgctgtg       300
     gcggatcggg tcgagctgtc ggatcagttc gacttccaaa gcgaagtggg attgggcagc       360
     agcggcgtcg aaccctccga acaagtggag ctcagtttgc tgctcgaaga gatggatcag       420
     atgatgcttc gactcgaacg tgcagatgat cagctcgccc tacttgaaac tctcgaacgt       480
     catcaccata tcgatgagga cacatactta tccggccgtc cgttatccaa aggctggcag       540
     tcgtcctcct tcggttaccg caacgatccc ttcaatggac gtcgtacctt acaccgggga       600
     ctggattttg ccggaccgga aggtggcgag gtgatcgcga cgggggcggg agtggtatcc       660
     tactccggca ccatgttcgg atatggcaat ctcgtagaga ttgaccacgg taacggtgtg       720
     aaaacccgtt acgggcataa taaggagaat ctggtggagc ttggccaggt ggtggccaag       780
     ggggaaaccg tcgcgcttat cggtaatacc gggcgctcaa ccggacccca tgtgcattac       840
     gaagtgatgc tcaacgatca acaggtggat cctgcgcggt acgtgtaccg caagcccaga       900
     acttaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page