(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE356

CP002209.PE356       Location/Qualifiers
FT   CDS_pept        392025..392453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0356"
FT                   /product="8-oxo-dGTPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020476: IPR000086: IPR003561; KEGG: mmw:Mmwyl1_2605
FT                   mutator MutT protein; PFAM: NUDIX hydrolase; SPTR: A0Y259
FT                   7,8-dihydro-8-oxoguanine-triphosphatase, prefers dGTP;
FT                   TIGRFAM: mutator MutT protein; PFAM: NUDIX domain; TIGRFAM:
FT                   mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74570"
FT                   /db_xref="GOA:E1SN71"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN71"
FT                   /protein_id="ADN74570.1"
FT                   /translation="MAALFYGTNESNDMAIVQVAIGLVVIDGAVLVAKRHKDQHQGGLW
FT                   EFPGGKVEPGETPEQAVIRECQEEVGLTLSQPELFDYIEHDYGDRQVQLSAFLATAAEG
FT                   EAHGREGNPLRWCPISELAQLPMPAANGRLIEKLLAAQ"
     atggccgccc ttttttatgg cacaaatgag agcaatgaca tggcgatagt gcaggtggcg        60
     attggtctgg tggtgatcga tggggcagta ctggtggcaa aacgccacaa agatcagcac       120
     cagggcggtt tatgggagtt ccccggggga aaagtggagc ccggtgaaac cccggagcag       180
     gcggtgatcc gagagtgtca ggaggaggtg gggctgaccc tgagccagcc ggagttgttt       240
     gattacatcg aacacgacta cggcgaccgc caggtgcagc tgagtgcgtt cctggccacc       300
     gccgcggagg gggaagcgca cgggcgtgaa ggcaacccgc tgcgctggtg tccgatcagt       360
     gagctggcgc agctgccgat gccggcagcg aacgggcggc tgattgagaa gttgttggcg       420
     gcgcagtaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page