(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE364

CP002209.PE364       Location/Qualifiers
FT   CDS_pept        complement(399475..399903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0364"
FT                   /product="methylation site containing protein"
FT                   /note="COGs: COG4969 Tfp pilus assembly protein major pilin
FT                   PilA; InterPro IPR002416: IPR012902: IPR001120; KEGG:
FT                   shm:Shewmr7_3604 methylation site containing protein; SPTR:
FT                   P45791 Pilus biogenesis protein tapA; PFAM: Prokaryotic
FT                   N-terminal methylation motif; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74578"
FT                   /db_xref="GOA:E1SN79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN79"
FT                   /protein_id="ADN74578.1"
FT                   /translation="MNRQVRKQQGFTLIELMIVVAIVGILAAIALPAYQTYTKKAKMTE
FT                   VAAATGGMKTAAEVCFQLNATNYATVCTAANELADQTQPNISIKYTAGNAPKITALTTA
FT                   ALGPVPSGVSYVLTGTVASSGQVTWAKSCTGEAASYCP"
     atgaaccgcc aagtacgtaa acagcagggt tttaccctga tcgaactgat gattgtggta        60
     gccattgttg gcattctggc ggccatcgcc ctgccggctt accagaccta caccaaaaaa       120
     gcgaagatga ccgaagtggc agccgctacc ggtggcatga aaactgcggc cgaggtgtgt       180
     ttccagttga atgccaccaa ctacgccact gtgtgtactg cggctaacga actggcagat       240
     caaactcagc ccaatatctc cattaagtac accgctggca atgccccaaa gattactgca       300
     ttaactaccg ctgcacttgg acccgtgccg tctggtgtta gctatgttct gaccggcacc       360
     gttgcatcct ctggccaggt aacttgggcc aagtcttgta ctggtgaagc tgcaagctac       420
     tgcccgtaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page