(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE365

CP002209.PE365       Location/Qualifiers
FT   CDS_pept        complement(400171..401028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0365"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR002638: IPR004393; KEGG:
FT                   shn:Shewana3_0422 nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]; PFAM: Quinolinate phosphoribosyl
FT                   transferase; PRIAM: Nicotinate-nucleotide diphosphorylase
FT                   (carboxylating); SPTR: A2UYJ7 Nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain; Quinolinate phosphoribosyl
FT                   transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74579"
FT                   /db_xref="GOA:E1SN80"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN80"
FT                   /protein_id="ADN74579.1"
FT                   /translation="MLENDIRLTVAAALDEDLGGQGPAQGDITAQLIPADRYAEATIIT
FT                   REDGVFCGKAWAEQVFNQLGGDVALHWHVDDGDLVVAGQTLCELAGPARLLLTGERTVL
FT                   NFIQTLSGVATTVSHYVAKLEGTQTRLLDTRKTLPGLRTAQKYAVTCGGGHNHRIGLFD
FT                   AFLIKENHIAACGGISPAIAAARQLRPEAPVEVEVENLEELKEALTGGADIVMLDNFDI
FT                   TMMLDAVTLNREQFEGRCKLEVSGDVTLATIGDFARTGVDFISVGALTKHVKAMDLSMR
FT                   FKAN"
     atgctggaaa acgacatccg cctcaccgtt gccgccgccc tcgatgaaga tctgggtggc        60
     caggggcccg ctcagggcga catcactgcg cagctgatcc cggccgatcg ttacgccgag       120
     gccaccatca tcacccgcga agacggcgta ttctgtggca aggcctgggc tgagcaggta       180
     tttaaccagc tgggcggcga cgttgcgctg cactggcatg tggacgatgg tgatctggtg       240
     gtggccggtc agaccctgtg tgagctggcc ggtccggccc gtctgctgct gaccggtgaa       300
     cgcaccgtac tcaactttat ccagaccctg tccggcgtcg ccaccaccgt cagccactac       360
     gtggccaagt tggagggcac ccagacccgt ctgctcgaca cccgcaaaac cctgccgggc       420
     ctgcgcactg cgcagaaata tgccgtcacc tgcggcggcg gtcacaacca ccgcatcggc       480
     ctgtttgacg ccttcctgat caaggaaaac cacatcgccg cctgcggtgg catcagcccg       540
     gccatcgccg ccgcccgcca actgcggccg gaggccccgg tggaagtgga ggtggagaat       600
     ctggaggagc tgaaagaagc cctgacaggt ggtgccgata tcgtgatgct ggataacttc       660
     gacatcacca tgatgctgga tgcggtcaca ctgaaccgcg aacagtttga gggccgctgc       720
     aagctggagg tgtccggcga tgttaccctg gccaccatcg gcgactttgc ccgcaccggc       780
     gtcgacttta tttccgtcgg tgcactgacc aaacacgtaa aagcgatgga tctgtccatg       840
     cgttttaagg cgaattga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page