(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE370

CP002209.PE370       Location/Qualifiers
FT   CDS_pept        404102..406768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0370"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG2609 Pyruvate dehydrogenase complex
FT                   dehydrogenase (E1) component; InterPro IPR004660; KEGG:
FT                   vpa:VP2519 pyruvate dehydrogenase subunit E1; SPTR: A3GNE4
FT                   Pyruvate dehydrogenase, E1 component; TIGRFAM: 2-oxo-acid
FT                   dehydrogenase E1 subunit, homodimeric type; PFAM:
FT                   Transketolase, thiamine diphosphate binding domain;
FT                   TIGRFAM: pyruvate dehydrogenase E1 component, homodimeric
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74584"
FT                   /db_xref="GOA:E1SN85"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN85"
FT                   /protein_id="ADN74584.1"
FT                   /translation="MSEPMNYDVDKQETQEWLESLAAVMQEDGLERAQFLLEQMISKAK
FT                   HEGVDLPTGITTNYINTIAPKDEPAYPGDSSLERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASYQSAASFYEVGFNHFFRAPNAQDGGDLVYYQGHISPGIYARAFLEGRLSEEQLD
FT                   NFRQEVDGKGIPSYPHPKLMPEFWQFPTVSMGLGPISAIYQARFLKYLDGRGMKDTSAQ
FT                   RVYAFLGDGEMDEPESRGALSFAAREGLDNLCFLINCNLQRLDGPVMGNGKIIQELEGL
FT                   FKGAGWNVVKVIWGNGWDKLLAKDTSGKLLQLMNETVDGDYQTYKAKNGAYVREHFFGR
FT                   YPETAALVADMTDDEIFALQRGGHSSSKLYAAYMNAKNTKGKPTVILAKTVKGYGMGGA
FT                   AEGMNIAHQVKKMNAEHVRQLRDRLGLKDLVSDEQLMDLPYLKLDESSPEYRYLHARRE
FT                   ALHGYTPQRLPNFTQELALPKLESFQGLLDEQKRDISTTMGFVRALNILLKDKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPKGQTYTPQDRDVVSYYKEATNGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHIMAGTIPNCISYDPTFAYEVAVIMQDGIQRMYGPAQENVFYYLTLM
FT                   NENYAQPAMPEGVEEGIRKGIYKLESHAGDNGKVQLLSSGTIMMQVREAARILADDYGI
FT                   GSDVFSVTSFNELTRDGQDAERWNMLHPTEQARVPYVTTVLGDAPAIAATDYMKNYAEQ
FT                   IRAFVPAQSYKVLGTDGFGRSDSRANLRRHFEVDAGYVVVAALSELAKQGKLDTAVVTE
FT                   AIAKFNIDADKQNPLYA"
     atgtcagaac cgatgaatta cgacgtagac aagcaggaaa ctcaggagtg gctggaatcg        60
     ctggccgccg tgatgcaaga ggacggcctc gaacgggccc agttcctgtt ggagcagatg       120
     atcagcaagg ccaagcacga aggcgttgac ctgcccactg gcatcacaac caactacatc       180
     aacaccattg ctcccaagga cgaaccggct taccccggtg acagcagtct tgagcgtcga       240
     atccgttcca tcatccgttg gaacgccatc atgatcgttc tgcgtgcttc caagaaagat       300
     ctcgatcttg gcggccacat ggcctcttac caatccgccg catctttcta tgaagtgggc       360
     tttaaccact tcttccgcgc ccccaacgcg caggatggcg gcgacctggt gtactaccag       420
     ggccacatct ctcccggcat ctacgcccgc gccttcctgg aaggccgcct gagcgaagag       480
     cagctggaca acttccgtca ggaagtggat ggcaagggca tcccctccta cccgcacccg       540
     aaactgatgc cggagttctg gcagttcccc accgtgtcca tgggtcttgg cccgatcagc       600
     gccatctacc aggctcgctt cctgaagtac ctggacggtc gtggcatgaa agacaccagc       660
     gcccagcgcg tttacgcctt cctcggtgat ggtgagatgg atgagccgga atcccgcggt       720
     gccctctcct ttgctgcccg tgaaggtctg gacaacctgt gtttcctgat caactgcaac       780
     ctgcagcgcc tcgatggccc ggtgatgggc aacggcaaga tcatccagga gctggaaggc       840
     ctgtttaagg gcgccggctg gaacgtggtg aaagtgatct ggggcaacgg ctgggacaag       900
     ctgctggcca aagacacctc cggcaagctg ctgcagctga tgaacgaaac cgtcgacggt       960
     gactaccaga cctacaaggc caaaaacggc gcttacgtgc gtgagcactt ctttggtcgt      1020
     tacccggaaa ccgctgccct ggtcgcggac atgaccgacg acgaaatttt cgccctgcag      1080
     cgtggtggtc actcctcttc caagctgtac gccgcctaca tgaacgccaa gaacaccaag      1140
     ggcaagccca ccgtgatcct ggccaaaacc gtaaaaggtt acggcatggg tggcgcggcg      1200
     gagggcatga acattgccca ccaggtgaag aagatgaatg ccgagcacgt gcgtcagctg      1260
     cgtgatcgtc tgggcctgaa agatctggtg tccgacgagc aactgatgga cctgccctac      1320
     ctgaagctgg atgagagcag cccggagtac cgctacctgc acgcccgtcg tgaagccctg      1380
     cacggttaca ccccgcagcg cctgcccaac ttcacccagg aactggcact gccgaagctg      1440
     gagagcttcc agggcctgct ggatgagcag aagcgtgaca tctccaccac catgggtttt      1500
     gtccgcgccc tgaacatcct gctgaaggac aaaggcatcg gtaagaacat cgtgccgatc      1560
     attgcggatg aagcccgtac ctttggtatg gaaggcctgt tccgccagat cggcatctac      1620
     aacccgaaag gccagaccta caccccgcag gaccgtgacg tcgtttccta ctacaaggaa      1680
     gccaccaacg gtcaggtact gcaggaaggg atcaacgagc tgggcgccat gtcctcctgg      1740
     gttgcggcgg ccacctcgta cagcaccaac gatctgccga tgatcccgtt ctacatctac      1800
     tactccatgt tcggcttcca gcgtgtgggc gatatggcat ggatggcggg tgaccaacag      1860
     gctcgcggct tcctgctcgg cgccactgcc ggccgtacca ccctgaacgg tgaaggcctg      1920
     cagcatgaag atggccacag ccacatcatg gcgggcacca tcccgaactg catcagctac      1980
     gatccgacct tcgcttacga agtggcggtg atcatgcagg acggcatcca gcgcatgtac      2040
     ggtccggctc aggagaacgt gttctactac ctgaccctga tgaacgagaa ctacgctcag      2100
     ccggccatgc cggagggtgt ggaagagggc atccgcaagg gcatctacaa gctggaaagc      2160
     catgctggcg acaacggcaa ggtgcagctg ctctcctccg gcaccatcat gatgcaggtg      2220
     cgtgaagcgg cccgcatcct ggcggacgat tacggcatcg gttccgacgt gttcagcgtg      2280
     acctccttca acgaactgac ccgcgacggt caggacgctg agcgctggaa catgctgcac      2340
     ccgaccgagc aggcgcgtgt gccttacgtc accaccgttc tgggtgacgc accggccatc      2400
     gctgccaccg actacatgaa gaactacgct gagcagatcc gtgcctttgt gccggcgcaa      2460
     agctacaagg tgctgggtac cgacggattc ggtcgctctg acagccgcgc caacctgcgt      2520
     cgtcacttcg aagtggacgc gggctacgta gtggttgcgg ccctgtccga actggccaaa      2580
     cagggcaagc tggacaccgc cgtggtgacc gaagcgattg ccaaatttaa catcgatgcc      2640
     gacaagcaaa acccgctgta cgcctaa                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page