(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE374

CP002209.PE374       Location/Qualifiers
FT   CDS_pept        complement(414738..415403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0374"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG0637 phosphatase/phosphohexomutase;
FT                   InterPro IPR005833: IPR005834: IPR006402; KEGG:
FT                   sdn:Sden_3378 2-deoxyglucose-6-phosphatase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: A2UV34
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74588"
FT                   /db_xref="GOA:E1SN89"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN89"
FT                   /protein_id="ADN74588.1"
FT                   /translation="MTHKIQAVIFDMDGVLVDSEPFWQQAELEILCDHGVPLTLEDTLK
FT                   TQGLRIDQVVGYWYQRHPWSGTSPELVADAILSRVVDLIAQQGEALSGVDSAISLIQQQ
FT                   GWALGLATSSPSRLVEATLSRLGLHSAFAVTCSAEHLRYGKPHPQVYLNAADELRVAPE
FT                   HAMAIEDSFNGLLAAKAARMTTLAVPDPHHRDDPRFVIADHRLDSLSQFTQSWLDTLN"
     gtgacccaca aaatccaagc agtaattttt gatatggacg gcgtcctggt ggattcggaa        60
     ccgttctggc aacaggcgga gctggagata ttgtgcgacc acggcgtccc actgacactg       120
     gaagacacgc tgaaaaccca gggcctgcgc atcgatcagg tggtgggcta ctggtaccag       180
     cgccacccct ggtccggcac ctcaccggag ctggtcgccg atgcgatcct gagtcgtgtg       240
     gtggacctga tcgcccagca gggggaggcc ctgtccggcg tcgacagtgc catctccctg       300
     attcagcaac agggctgggc actgggactg gccacctcct ccccaagtcg gctggtggaa       360
     gcgacgctgt cccgattggg tctgcacagt gcctttgcgg tcacctgctc ggccgaacat       420
     ctgcgctacg gcaaacccca cccgcaggtt tacctcaatg ccgccgatga gttgagggtg       480
     gcgccggagc acgccatggc catcgaggat tccttcaacg gcctgctggc cgccaaagcc       540
     gcccggatga ccacgctggc ggtgccggac ccgcaccacc gtgacgaccc ccgcttcgtg       600
     attgccgatc accgcctcga cagtctgagc cagttcaccc agtcctggct cgacaccctc       660
     aactga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page