(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE377

CP002209.PE377       Location/Qualifiers
FT   CDS_pept        complement(419572..420048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0377"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="COGs: COG3160 Regulator of sigma D; InterPro
FT                   IPR007448; KEGG: sse:Ssed_0439 anti-RNA polymerase sigma 70
FT                   factor; PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; SPTR: A2UV32 Regulator of RpoD, Rsd/AlgQ; PFAM:
FT                   Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74591"
FT                   /db_xref="GOA:E1SN92"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN92"
FT                   /protein_id="ADN74591.1"
FT                   /translation="MLTKLERAVDAWGGSNTLIDNWLESRRQLLIHYCQLAGLPPYEGE
FT                   KGHLPDETRVQQFCNLLVDYMSEGHFEVYDQVSTACEQSGEHAKALAQSLVPKISASTD
FT                   AALDFNDKYTNGVNDDIMMELDQDLSELGQKMEERFELEDRLLEALFERHSEAS"
     atgctgacaa agttagaaag ggccgtggac gcctggggag gctccaatac gcttatcgat        60
     aactggctgg aaagtcgtcg tcagttactg atccactact gccaactggc cggattaccg       120
     ccctatgagg gggagaaggg ccaccttccg gacgaaaccc gcgttcaaca gttctgcaat       180
     ctgctggtgg actacatgtc tgaggggcat tttgaggtct acgaccaggt atccactgcc       240
     tgcgagcaga gtggcgaaca cgccaaggcc cttgcccaaa gcctggtgcc caaaatctcc       300
     gccagtaccg atgccgcgct cgatttcaac gacaagtaca ccaacggcgt caatgacgac       360
     atcatgatgg agctggatca ggatctgtct gaactgggcc agaagatgga ggagcggttc       420
     gaactggaag accgtttgct tgaagcgctg tttgagcgtc acagcgaagc cagctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page