(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE379

CP002209.PE379       Location/Qualifiers
FT   CDS_pept        421619..422710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0379"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139: IPR013196: IPR011611: IPR002173; KEGG:
FT                   slo:Shew_2725 ribokinase-like domain-containing protein;
FT                   PFAM: PfkB domain protein; Helix-turn-helix type 11 domain
FT                   protein; SPTR: P33020 Uncharacterized sugar kinase yeiI;
FT                   PFAM: HTH domain; pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74593"
FT                   /db_xref="GOA:E1SN94"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN94"
FT                   /protein_id="ADN74593.1"
FT                   /translation="MTEREQQILDLIRQDPLIPQQELADKLGISRSAIAGHIMHLTQKG
FT                   HIQGKGYILAPERYALVIGGANMDLCGVADRPLVDGDSTPGSLTASAGGVGRNIADNLA
FT                   RLGSRVEFVSALGDDRWAEQLIESCRLAGVGTEHCLKIAGATTSSYLSLHDSDGEMRLA
FT                   LNDMSLIERLDAEQMERRRGPIDRASVVVLDANLSEDALETLFARPLDAPVLVDPVSRA
FT                   KAHKLKPFLAQIDTLKPNALEAELLSGHRLDSDEDLPRVADALHQLGVKRVLLSLGSRG
FT                   AYASDAGQGVRYLPSATDVVNVTGAGDALMAGLAHGRLAGWSFTETVPFALAAARLALA
FT                   TKTTINSTMSEAAVRRLMEKTPC"
     atgacggagc gagagcagca gatcctcgac ctgatccgcc aggatcccct gatcccccag        60
     caggagctgg cggacaagct gggcatcagt cgcagtgcca tcgcgggcca catcatgcac       120
     ctcacccaga aaggccacat ccagggcaaa ggttacattc ttgcccctga gcgctacgcg       180
     ttggtgattg gtggggccaa tatggacctg tgcggcgtgg ccgaccggcc gctggtggac       240
     ggtgactcca ccccgggcag cctgactgcc agcgccggtg gtgtgggccg caatatcgcc       300
     gacaacctgg ctcgcctggg cagccgcgtc gagtttgtct ctgcccttgg tgatgaccgc       360
     tgggccgagc agctgattga atcctgccgt ctggctgggg tgggtacaga gcactgcctg       420
     aagatcgccg gtgccaccac ctccagttac ctgtcgctgc acgacagcga tggcgagatg       480
     cgcctcgccc tcaatgacat gagcctgatt gagcgcctcg acgctgagca gatggagcgc       540
     cgccgtggcc ccatcgaccg cgcttcggtg gtggtgctgg atgccaacct gtccgaagac       600
     gcactggaaa ccctgtttgc ccgcccactg gatgccccgg tgctggtgga cccggtgtcc       660
     cgcgccaagg cgcacaagct caagcctttc ctggcccaga tcgacaccct caagcccaac       720
     gcgctggaag cggagttgct gtccggccat cgtctcgaca gcgacgaaga cctgcctcgt       780
     gtggctgatg cgctgcatca gttgggggtc aagcgggtgc tgctcagcct gggcagccgt       840
     ggcgcctacg cctccgatgc ggggcagggc gtccgctacc tgccgtccgc caccgatgtg       900
     gtgaacgtca ccggcgccgg tgatgcgctg atggcgggcc tggcccatgg ccgccttgcc       960
     ggctggtcct ttaccgagac cgttcctttt gccctggccg ctgcccgact ggcgctggcg      1020
     accaagacca ccattaattc cactatgtcc gaagcggccg tacgccgcct gatggagaag      1080
     accccatgct ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page