(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE38

CP002209.PE38        Location/Qualifiers
FT   CDS_pept        complement(46976..49642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR006626: IPR010916; KEGG: slo:Shew_2404
FT                   hypothetical protein; SPTR: A1ZQZ9 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74252"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022269"
FT                   /db_xref="InterPro:IPR022442"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV98"
FT                   /protein_id="ADN74252.1"
FT                   /translation="MREKRSWLLPTLLASAVALNLAGCGSDDETVTVTPPPPTTTPPEP
FT                   EGPTFPEGAIMVEVGENLGANITEAFINAQSGDVIVLPEGEFKLDRTLLFDGDADGDGV
FT                   FAKNVTIMGYGQDKTILDFSEAASGDGIFVQNAVNITIQDLSVNEAKNNGIKLKNSNGI
FT                   ILRRLATIWAGELNEENGAYGLYPVECQNILIEDTYVRGSADAGIYVGQSEYIVVRRNV
FT                   AIENVAGIEIENSKYADVYDNHAVANTGGILVFDLPIGNHRYGSSVRIFDNLVEGNNTK
FT                   NFANASANPAGVHIVPPGTGIIILSTDDVEIFNNVIRDHDTLSITASSFFIAEPDVTGA
FT                   FAMNYAQPGGIIDDGWRAVPRNIHIHSNEITNSGSNPNGYLIEDIIGAYTQIHGVFPAI
FT                   LYDGLGEAVANSGLFAGPSAMIDYKEPPFAADGSDNVCVSNNGDVSLGQLYAGDHSPAT
FT                   LEVPDILFESSQDKLMNCTQVSLPVHTVTIGDEVFGCGIDDDTAGCDGGETVGNGGSIG
FT                   EGEGGLVGDGDLSLCEASGSEVNWSALLGANCANLSDYNLFADSANPKGAANSGGMPYD
FT                   LNSPLFTDYTSKYRYVFVPGGEAAAYDAQEVFDFPVGTVLVKTFAMPDDTATPGNENEE
FT                   ILETRLLIHREAGWSALPYVWNANKDEAVLAKPGSIMNQSVVHKGETIEFDYVVPSLNQ
FT                   CKQCHQYSGEDGIARFMPIGPKARHLNGNYEYADGSTNQLTAWTAHGILTGTPADLASI
FT                   PTVPAFELLGNGDLSGATDAEVMDLAKGYLDINCAHCHRPEGNASNTGLKLEYWRPYEG
FT                   NEQAHGECKSPVAYGGGSLGYDIVPGNPDESITHFRMAATEPGDRMPEIGRSLAHDAGV
FT                   DLIREWITRLPAATCSE"
     atgcgggaga agcgatcctg gttactgccg accctattgg cgtccgcagt ggccctcaac        60
     ctggccgggt gcggcagcga cgatgaaacc gtaacggtca cgccaccgcc gccgaccacc       120
     accccgccgg agccggaagg accgaccttc ccggaaggcg ccatcatggt cgaagtgggt       180
     gagaacctcg gcgccaacat caccgaagcc tttattaatg cccagagtgg cgacgtcatc       240
     gtactgccgg aaggcgagtt caaactcgac cgcaccctgc tgttcgacgg cgacgcggat       300
     ggagatgggg tgtttgccaa gaacgtgacc atcatgggtt acggtcagga caaaaccatc       360
     ctcgacttct cggaagcggc ctccggggac ggcatctttg tgcagaacgc cgtcaacatc       420
     accattcagg acctgtccgt taacgaagcc aagaacaacg gcatcaagct gaagaactcc       480
     aacggcatca tcctgcgtcg tctggccacc atctgggctg gcgagttgaa cgaagagaac       540
     ggcgcctacg gtctctaccc ggtggagtgt cagaatatcc tgattgaaga cacctacgtg       600
     cgcggctccg ccgatgcggg catctacgtg ggtcagtccg aatacatcgt ggtgcgtcgc       660
     aacgtggcca tcgaaaacgt cgcgggcatc gagattgaaa actccaagta cgccgacgtt       720
     tacgataacc acgcggtcgc caacaccggt ggtattctgg tgttcgacct gcccatcggt       780
     aaccaccgtt acggcagcag cgtgcggatc ttcgataacc tggttgaagg caacaacacc       840
     aagaactttg ccaacgccag cgccaacccg gccggggtac acatcgttcc gcccggcacc       900
     ggcatcatca ttctgtccac cgacgacgtt gagatcttca acaacgtcat ccgcgaccac       960
     gacaccctgt ccattaccgc ctccagcttc tttattgctg agccggacgt gaccggggcg      1020
     ttcgccatga actatgccca gcccggcggc atcatcgatg atggctggcg cgcggtaccg      1080
     cgcaatatcc acatccacag taacgagatc accaacagtg gcagcaaccc caatggttac      1140
     ctgatcgaag acatcatcgg cgcctacacc cagatccacg gcgtgttccc ggcgattctg      1200
     tacgatggcc tcggtgaagc tgtggccaac agcggcctgt ttgccggccc gagcgcgatg      1260
     attgattaca aggagccgcc gtttgccgct gatggcagtg acaacgtctg tgtgtccaac      1320
     aacggcgacg tgtccctggg tcagctctac gccggtgacc actctcccgc cacgctggaa      1380
     gtgccggaca tcctgtttga gagcagccag gacaagctga tgaactgtac ccaggtatcg      1440
     ctgccggttc acaccgtcac catcggtgat gaggtgttcg gttgtggtat cgacgacgac      1500
     acggccggct gtgatggcgg tgagaccgtc ggcaatggcg gcagcatcgg cgaaggggaa      1560
     ggcggactgg tgggtgacgg cgacctgagc ctgtgtgaag ccagcggcag cgaagtgaac      1620
     tggagtgccc tgctgggcgc caactgcgcc aacctgtctg actacaacct gtttgccgac      1680
     agcgccaatc cgaaaggtgc agccaacagc ggcggcatgc cctatgacct gaacagcccg      1740
     ctgttcaccg actacaccag caagtaccgc tacgtgttcg tccccggtgg cgaagccgca      1800
     gcgtacgacg cgcaggaggt gttcgacttc ccggtgggta ccgtactggt gaaaaccttc      1860
     gccatgccgg atgacactgc cacgccgggc aacgaaaacg aagagatcct ggaaacccgt      1920
     ctgcttatcc atcgtgaagc cggttggagt gccctgccct acgtctggaa cgccaataaa      1980
     gacgaagcgg tactggccaa gcctggcagc atcatgaatc agtccgtggt ccacaaaggt      2040
     gaaaccatcg agtttgacta tgtggttccg agcctgaacc agtgtaagca gtgtcaccag      2100
     tacagtggtg aggatggcat cgcccgcttt atgccgattg gcccgaaagc ccgccacctc      2160
     aatggcaact acgagtacgc cgatggcagc accaatcagc tgaccgcctg gaccgcccac      2220
     ggcatcctga ccggcacgcc ggctgacctg gcctccatcc ccaccgttcc ggcctttgag      2280
     ctgctgggta acggtgacct gagcggtgcc accgacgccg aagtgatgga cctggccaag      2340
     ggctacctgg acatcaactg tgcgcactgc caccgccctg aaggcaacgc ctccaacacc      2400
     ggcctcaagc tggagtactg gcgtccttac gagggcaatg agcaggccca cggtgagtgt      2460
     aagtcgccgg tggcctatgg cggcggttcc ctgggttacg acatcgtccc gggcaacccg      2520
     gatgagtcca tcacccactt ccgcatggcc gccaccgaac cgggtgaccg gatgccggag      2580
     atcggccgca gcctggccca tgacgcaggg gtcgacctga tccgcgagtg gattacccgc      2640
     ctgcctgcag ccacctgctc cgagtaa                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page