(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE380

CP002209.PE380       Location/Qualifiers
FT   CDS_pept        422704..423621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0380"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="COGs: COG2313 Uncharacterized protein involved in
FT                   pigment biosynthesis; InterPro IPR007342; KEGG:
FT                   sse:Ssed_1352 indigoidine synthase A family protein; PFAM:
FT                   Indigoidine synthase A family protein; SPTR: P33025 UPF0724
FT                   protein yeiN; PFAM: Indigoidine synthase A like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74594"
FT                   /db_xref="GOA:E1SN95"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN95"
FT                   /protein_id="ADN74594.1"
FT                   /translation="MLEKYLDIHPEVAEAIANNRPVVALESTIISHGMPYPQNVETALK
FT                   VEQTVRDAGAIPATIAIIKGRLTVGLTEEQVEFLGKEGLSVTKASRRDIPFIVAAGKTG
FT                   ATTVASTMILAAMAGIKVFATGGIGGVHRGAQQTFDISADLQELANTDVAVVCAGAKSI
FT                   LDLGLTREYLETFGVPVVGYQTDCLPAFYTRESDFSIDYRLDSSEAIATALNAKWGMGL
FT                   KGGVVIANPIPEQYAMPKADIDAAIAQALAEAEQQGVGGKESTPFLLARVCELTGGNSL
FT                   DSNIQLVLNNARLASGIARDLCAE"
     atgctagaga agtacctgga tatccacccg gaagtcgccg aagccatcgc caacaaccgc        60
     ccggtcgtgg cgctggagtc caccatcatc tcccacggta tgccttaccc gcagaacgtg       120
     gagaccgccc tgaaggtgga gcagaccgtt cgtgacgcgg gtgccatccc ggccaccatc       180
     gccatcatca agggccgcct gaccgtgggc ctgaccgaag agcaggtaga gttcctgggt       240
     aaagagggtc tgtccgtcac caaggcttcc cgtcgtgaca tcccctttat cgttgctgcc       300
     ggtaaaaccg gtgccaccac cgtagcgtcc accatgatcc tggccgccat ggccggcatc       360
     aaagtgtttg ccaccggtgg cattggcggc gtgcaccgtg gtgcccagca gaccttcgac       420
     atctccgctg acctgcagga actggccaac accgacgtgg ccgttgtctg tgccggtgcc       480
     aagtccatcc tcgacctggg cctgacccgc gagtacctgg aaaccttcgg tgtgccggtt       540
     gtcggctacc agaccgactg cctgccggcg ttctacaccc gcgaaagcga tttcagcatc       600
     gactaccgcc tggacagcag cgaagccatt gccactgcgc tgaacgccaa gtggggtatg       660
     ggcctgaaag gcggtgtggt gatcgccaac ccgatcccgg aacagtacgc catgccgaaa       720
     gctgacatcg atgccgccat cgctcaggcg ctggcggaag cggagcaaca gggtgttggt       780
     ggcaaagagt ccaccccgtt cctgctggcc cgcgtctgtg aactgaccgg tggtaacagc       840
     ctggattcca acatccagct ggtactgaac aacgcccgcc tggcttccgg gattgctcgc       900
     gacctgtgcg ctgagtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page