(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE382

CP002209.PE382       Location/Qualifiers
FT   CDS_pept        424389..426956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0382"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160: IPR013767: IPR013656: IPR 000700: IPR000014;
FT                   KEGG: son:SO_0437 sensory box protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; SPTR: A2UV29
FT                   Diguanylate cyclase/phosphodiesterase with PAS/PAC
FT                   sensor(S); TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: EAL domain; GGDEF domain; PAS fold; TIGRFAM:
FT                   PAS domain S-box; diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74596"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN97"
FT                   /protein_id="ADN74596.1"
FT                   /translation="MKLSRRLLLLLFCLAIPLILTATGAAYWMIRDGFVGYEQRTYAAE
FT                   RAHLQMDVEHWLTQNRKSMTAIRTALESERPEALDFLVAQARQRGLISLVMNHHGELHV
FT                   LQNPALPVDGNSEAMRALLDPILSTGTFQYERSGFARLGHQVFGLVAQPLNHRNWRGLI
FT                   GIQAFDQTLLDTLSYRHHRIHTATLVDAPEGSPLALPHFAGTALTLEPQFDLTERQIRT
FT                   EQIHRVMAILALVLVLLALASFFTFRRILLGPIGSLKQRIEQGLTQRKTSRPLPESGQD
FT                   ELSEISQLCNELFSQRLHQRQQISTLLRTVSDAVVLVDPQARIELVNPEAEKLLAVEHG
FT                   PVRQCALVNLVAGPAGQELHAALKELLSSGRISLEGRVSLQQGGQKRQLEYHAARTLDH
FT                   EGHTLGAVLVLRDITHSEQMKRELMHKSQRDQTTGIYNRHTFEQRLEALADLPGQHAIC
FT                   YMDLNRFKLINDSCGHEAGDRMLRDVAQEMVRSIRPGDLLARIGGDEFGLIMKDTSALE
FT                   TARVLKQLMERVEGITLYWDSGSYRVGISIGVAFQRADEQRPREVFKDAEIACHANKGK
FT                   GGESQIHFFDSLDQDLAHQRNAPQWAMKINEAIVNDDLVLFYQPIEPVQASSPRRKCEV
FT                   LLRIREEGGRILAPGQFIAAAERFNLMPAVDKAVIRKSFEWLARNSHLWNTQVLSINLS
FT                   GTTLSNGNLVSYIDEMCALYRVPPETICFEVTETAAIANENRALEILHALRRRGFAFAL
FT                   DDFGSGFASYGYLRQLPVDYVKIDGCFVRNLANNAKDYAIVKSIHDVCRVMGIETVAEF
FT                   VEDQETLSRLRAIGVNYAQGYGIGRPKDLETYQPVPQEDGVKA"
     atgaaactct cccgtcgatt attgctgctc ctgttttgtc tggctatccc cctgatcctg        60
     accgccaccg gcgccgccta ctggatgatc cgtgacggct ttgtcggcta tgagcagcga       120
     acctacgccg ccgagcgggc gcatctgcag atggatgtgg agcactggct gacgcagaac       180
     cgcaaatcga tgacggcgat ccgcaccgca ctggagagtg aacgcccgga agcgctggat       240
     tttctggtgg cccaggcccg tcagcgcggc ctgatctctc tggtgatgaa ccaccacggt       300
     gagttgcacg tgttgcagaa cccggcgttg ccggtggacg gcaacagcga agcgatgcgg       360
     gccctgctcg atcccattct ctccaccggt acctttcagt acgagcgcag cggctttgcc       420
     cgtcttggcc atcaggtgtt tgggctggtg gcccagccac tgaaccatcg caactggcgt       480
     ggactgattg gcattcaggc gtttgatcag actctgctgg acaccctcag ctatcgccac       540
     caccgcatcc ataccgccac cctggtggat gccccggaag gcagccccct ggcgctgccc       600
     catttcgccg ggacagccct gacccttgag ccgcagtttg acctgactga acgtcagatc       660
     cgcaccgaac agatccatcg ggtgatggcg atactggcgc tggtactggt gctgttggca       720
     ctggccagtt tctttacctt ccgtcgcatt ctgctggggc ccatcggcag cctgaagcag       780
     cgcatcgaac agggcctgac tcagcgcaaa accagtcggc cgctgccgga atccgggcag       840
     gatgagctgt ctgaaatcag ccagctgtgt aatgagctgt tttcccaacg cctgcaccag       900
     cgtcaacaga tcagcaccct gctgcgcacc gtcagcgatg cggtggtgct ggttgaccca       960
     caggcgcgta tcgagctggt gaacccggaa gcggaaaagc tgctggcggt cgagcatggt      1020
     ccggtgcgcc agtgtgccct ggtcaatctg gtggccggcc cggcgggaca ggaactgcat      1080
     gccgccctga aagagctgct cagctcaggc cgcatcagcc tcgaagggcg ggtatcgctg      1140
     caacaggggg gtcagaaacg gcaactggag taccacgctg cccgtacgct ggaccatgag      1200
     gggcataccc tgggggcggt cctggtgctg cgtgacatca cccattccga gcagatgaag      1260
     cgcgagttga tgcacaagtc ccaacgggac cagaccaccg gcatctacaa ccgccacacc      1320
     tttgaacagc ggctggaagc gctggcagat ctgccgggcc agcacgccat ctgctacatg      1380
     gatctgaacc gctttaagct gatcaacgac agttgtggcc acgaagccgg tgaccgcatg      1440
     ctgcgcgatg tggctcagga gatggtgcgg agcatccgcc cgggcgacct gctggcgcgc      1500
     atcggcggcg atgaattcgg cctgatcatg aaagacacct cagcgctgga gacggcgcgg      1560
     gtgctgaaac agctgatgga gcgggtcgag gggatcactc tttactggga cagtggcagc      1620
     taccgggtgg gcatcagcat cggggtggcg ttccagcggg cggatgagca gcggccccgt      1680
     gaggtgttta aagacgctga aatcgcctgt cacgccaata agggcaaggg cggcgaaagc      1740
     cagatccact tcttcgactc cctcgatcag gatctggccc accagcgcaa cgcgccgcag      1800
     tgggcgatga agatcaacga agcgatcgtc aacgacgatc tggtgctgtt ctatcagccc      1860
     attgagccgg tgcaggccag cagtccccgt cgcaagtgcg aagtgctgct gcggatccgc      1920
     gaagagggcg gccgcatcct ggcgccgggc cagtttattg ctgcggcgga gcgttttaac      1980
     ctgatgccgg cggtggacaa ggcggtgatc cgcaaatcct ttgagtggct ggcccgcaac      2040
     agccacttgt ggaataccca ggtgctgtcg atcaacctct ctggcactac cctctccaac      2100
     ggcaatctgg tcagctacat cgatgagatg tgcgcgctgt accgggtgcc gccggaaacc      2160
     atctgcttcg aggtgaccga aaccgccgcc atcgccaacg agaaccgggc actggagatc      2220
     ctccacgccc tgcgccgtcg cggtttcgct tttgccctgg atgactttgg ctccggcttt      2280
     gcttcctatg gctacctgcg ccagttgccg gtggattacg tgaagatcga cggctgcttt      2340
     gtccgtaacc tggccaacaa cgccaaggat tacgccatcg ttaaatcgat tcacgatgtg      2400
     tgccgggtga tgggcatcga aaccgtggcg gagtttgttg aggaccagga aaccctgtcc      2460
     cggcttcgcg ccatcggcgt taactacgcc caggggtacg gcatcggccg acccaaagat      2520
     ctggaaacct accagccggt accgcaggag gatggcgtta aagcctga                   2568
//

If you have problems or comments...

PBIL Back to PBIL home page