(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE384

CP002209.PE384       Location/Qualifiers
FT   CDS_pept        complement(427740..428648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0384"
FT                   /product="Patatin"
FT                   /note="COGs: COG4667 esterase of the alpha-beta hydrolase
FT                   superfamily; InterPro IPR002641; KEGG: vpa:VPA1288
FT                   hypothetical protein; PFAM: Patatin; SPTR: A0XXZ8 Putative
FT                   ratatin-like phospholipase or esterase of the alpha-beta
FT                   hydrolase superfamily protein; PFAM: Patatin-like
FT                   phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74598"
FT                   /db_xref="GOA:E1SN99"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN99"
FT                   /protein_id="ADN74598.1"
FT                   /translation="MDQVGPSALIVEGGAMRGVFSCGVLDTFLARDFSPFDSFWGVSAG
FT                   ASNLAAYLAKMPGRNRKIYTDYSCRRAFLTPGRFLRGGDLMDLDWMWTITLAELGIDKA
FT                   VLAADPRPFFLAVTRQDSGQAEYHTPDVEQLAETMKASSALPVLYRKGVRLGQHTYVDG
FT                   GVADALPVAEAIRRGARQIMVLRSRPASYRKSASGLPALQRWLLRDTPHLVEPMLSRAE
FT                   RYNRTLDLIRQPPEGVNIVEICPPESFRLKRLTRDAEPLERGYELGRIAGEAAMARWQP
FT                   FSGDGQSPAPQCHRSNPAPAV"
     atggatcagg tagggccaag cgcattaatc gtggaaggcg gcgccatgcg aggggtgttt        60
     tcctgcggcg tactggacac ctttctggcc cgggacttca gtccctttga cagtttctgg       120
     ggcgtctcgg ccggcgcctc caatctggca gcttacctgg ccaagatgcc gggccgtaac       180
     cgcaaaatct acaccgacta cagctgccgc cgggcgtttc tgaccccggg ccgttttctg       240
     cgtggcggcg acctgatgga tctggattgg atgtggacca tcactctggc ggagttgggc       300
     atcgacaagg ctgttctggc cgcagacccc cgtcccttct ttctggcggt tacccgccag       360
     gacagcggac aggcggaata ccacaccccc gacgttgagc agctggccga aaccatgaag       420
     gccagcagtg ccctgcccgt gctgtaccga aaaggggtgc ggctggggca acacacctac       480
     gttgatggcg gggtggcgga tgcgctgccg gtggccgagg cgattcgtcg cggtgcacgc       540
     cagatcatgg tgctgcgcag ccgaccggcc agctaccgca aatccgcttc cggcctgccc       600
     gccctgcaac gctggctgct gcgtgatacc ccgcatctgg ttgaaccgat gctgagccgg       660
     gcggaacgct acaaccggac gctcgacctg atccgccagc cgccggaagg ggtgaacatc       720
     gttgagatct gcccgccaga atccttccgg ctgaagcggc tgacccggga cgccgagcct       780
     ctggagcgag gctatgagct gggccggatc gcgggcgaag cggcgatggc ccgttggcaa       840
     ccgttcagtg gcgacgggca atcgcccgcg ccgcaatgcc atcgatcaaa cccggcgcca       900
     gcagtttaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page