(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE389

CP002209.PE389       Location/Qualifiers
FT   CDS_pept        434077..435144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0389"
FT                   /product="arsenical-resistance protein"
FT                   /note="COGs: COG0798 Arsenite efflux pump ACR3 and related
FT                   permease; InterPro IPR002657: IPR004706; KEGG: sde:Sde_3779
FT                   arsenical pump membrane protein, putative; PFAM: Bile
FT                   acid:sodium symporter; SPTR: A3WN53 Arsenical pump membrane
FT                   protein, putative; TIGRFAM: arsenical-resistance protein;
FT                   PFAM: Sodium Bile acid symporter family; TIGRFAM:
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74603"
FT                   /db_xref="GOA:E1SNA4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA4"
FT                   /protein_id="ADN74603.1"
FT                   /translation="MGNFERYLSVWVGLAIVAGVALGHAFPVVFETLAQWQMFQINGVI
FT                   AVLIWVMIYPMMIQVDFHSVRKVGQQPQGLWLTLVVNWLIKPFSMAAIGWLFFRVFFVD
FT                   LVSPEDASQYIAGMILLGVAPCTAMVFVWSQLTRGNPAYTLVQVSVNDLIMVVAFAPIA
FT                   ALLLGVSEILVPWETLLLATLLYVALPLVAGILTRHLLMKRGEAALNGFVQRLKPASMV
FT                   GLLATVAILFGIQAPTLLAKPMVIGLIAIPLLLQTYGIFAIAYGSARVMKLPHNVAAPA
FT                   AMIGTSNFFELAVAVAIALFGLHSGAALATVVGVLVEVPVMLSLVAFANRTRHWFPASA
FT                   DAPDTLNANAQRDAA"
     atgggcaatt tcgagcgtta cttaagtgta tgggtgggcc tggcgatcgt cgccggtgtg        60
     gcgttgggcc atgcctttcc cgttgtattt gaaaccctgg cgcaatggca gatgttccag       120
     atcaacggcg ttatcgcggt gctgatctgg gtcatgatct acccgatgat gatccaggta       180
     gacttccatt cagtgcgcaa ggtggggcag cagcctcagg gcctgtggct gaccctggtg       240
     gttaactggc tgattaagcc gttctccatg gcggccatcg ggtggctgtt tttcagagtt       300
     ttctttgtcg atctggtgtc gccggaagac gccagccagt acatcgccgg gatgatcctg       360
     ctcggggtcg cgccctgtac cgccatggtg tttgtctgga gccagctgac ccggggcaat       420
     ccggcgtaca ccctggttca ggtgtcggtg aatgacctga tcatggtggt ggcgtttgcc       480
     cccattgccg ccctgttgct gggggtgtct gagatcctgg tgccctggga aaccctgttg       540
     ctggccacgc tgttgtatgt ggcgctgcca ttggtggcgg gcatcctgac ccgtcatctg       600
     ctgatgaagc gcggcgaggc ggccctgaac ggttttgttc agcgtctgaa acccgcctcg       660
     atggtgggct tgctggccac cgtcgccatc ttgtttggca tccaggcgcc gaccctgctg       720
     gccaagccga tggtgattgg gctgatcgcc attccgctgc tgctgcaaac ctacggcatc       780
     tttgccatcg cctatggcag cgccagggtg atgaagctgc cgcacaacgt ggcggcaccg       840
     gcggcgatga tcggcacctc aaacttcttt gaactggcgg tggcggttgc cattgccctg       900
     tttggcctgc actccggtgc ggccctggcg accgtggtgg gggtactggt ggaggtgccg       960
     gtgatgctct ccctggtggc ctttgccaac cggacccgcc actggtttcc cgcttcggcc      1020
     gatgcgccgg acacccttaa cgctaatgca cagagagacg cagcatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page