(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE393

CP002209.PE393       Location/Qualifiers
FT   CDS_pept        437968..438462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0393"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   swd:Swoo_1851 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: A2UVD1 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74607"
FT                   /db_xref="GOA:E1SNA8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA8"
FT                   /protein_id="ADN74607.1"
FT                   /translation="MSITIRRAEPSDAEALQATMSAEICFSNTLQLPWPSLTMWQQRLA
FT                   QLGPDQHLLVAENDAGDVVGNLMLAQASNPRRRHVAEIGMAVVPEWQGRGVGSALLQAA
FT                   INLGEQWLALTRLELDVYTDNEAALALYRRHGFEPEGIARAAAFRDGARVDVMRMARIR
FT                   D"
     atgtccatca ccatccgtcg cgccgaaccc agcgatgctg aggccttgca ggccaccatg        60
     tccgccgaga tctgtttcag caataccctg caactgccgt ggccatccct caccatgtgg       120
     cagcagcggc tggcgcagct gggccctgat cagcacctgc tggtggctga aaacgacgcg       180
     ggtgacgtgg tgggcaacct gatgctggcc caggccagta acccgaggcg gcgtcacgtt       240
     gctgagattg gcatggcagt cgtacctgag tggcaggggc gcggcgtcgg cagtgccctg       300
     ttgcaggcgg cgatcaacct gggagagcag tggctggcgc tgacccggct ggagctggat       360
     gtctataccg acaacgaggc ggctctggcg ctgtatcggc gccacggctt tgagccggag       420
     gggatcgccc gcgccgcggc gtttcgcgat ggggcgcggg tcgatgtgat gcggatggcc       480
     cggatccggg attaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page