(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE4

CP002209.PE4         Location/Qualifiers
FT   CDS_pept        3902..6319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit; InterPro
FT                   IPR001241: IPR000565: IPR002288: IPR006171: IPR 003594:
FT                   IPR013506: IPR018522: IPR011557; KEGG: vvy:VV0014 DNA
FT                   gyrase subunit B; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; PRIAM: DNA topoisomerase (ATP-hydrolyzing);
FT                   SMART: DNA topoisomerase II; ATP-binding region ATPase
FT                   domain protein; SPTR: O51859 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: Toprim domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; DNA gyrase
FT                   B; DNA gyrase B subunit, carboxyl terminus; TIGRFAM: DNA
FT                   gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74218"
FT                   /db_xref="GOA:E1SUL3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL3"
FT                   /protein_id="ADN74218.1"
FT                   /translation="MAENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSDIVVTIHADGSVSVQDDGRGIPVDMHPEEGVSAAQVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLELTVRRQGHIHEQEYSLGDPVAPLKAVGDTDK
FT                   TGTTIRFWPSSQIFSDTTFHYDILAKRLRELSFLNSGVSIRLVDERDAKEDHYCYEGGI
FT                   HAFVEFLNQNKTPVHQQVFHFTIEREDGIGVEVAMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNNYMDKEGYSKKAKTSASGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQTMGEQLQDFLLENPGDAKTVVSKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKYQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITAMGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPELIERGYIYIAQPPLYKVKKGKQERYIKDEAALTEYLTSLALDNASLHVNQDAPGI
FT                   SGEHLERLVNQYREVQDVVERQSRRFPKSLLNKLVYVPGLSEGSLKDKAEITEWTERLV
FT                   SELNELDLEGATYRYELQEESERGLWLPKLVLRQHGVESNYLLTFDFINSSDYGRIVAL
FT                   GNAIGDLMEEGAYVRRGERTLPVDSFEKGLTWLMNESKRGLYIQRYKGLGEMNPDQLWE
FT                   TTMDPETRRMLRVTIEDAIGADQLFTTLMGDQVEPRRDFIEKNALLVANLDV"
     atggcagaaa atagctacga ttcctcgagt attaaggtac tcaaaggcct ggacgcagtg        60
     cgtaagcgcc cgggtatgta catcggtgac accgacgacg gtaccggtct gcaccacatg       120
     gtgtttgagg tcgtggataa ctccatcgac gaagccctgg cgggtcactg cagcgacatc       180
     gtggtcacca tccatgccga cggttctgtt tccgtacaag atgatggccg gggtatcccg       240
     gtggacatgc acccggaaga gggcgtgtcc gcggctcagg tgatcatgac cgtactgcac       300
     gccggcggta agttcgacga caactcctac aaagtctccg gtggtctgca cggggtgggt       360
     gtgtcggtgg tgaacgcgct gtccgacaag ctggaactga ccgttcgtcg tcagggccac       420
     atccatgagc aggagtacag cctgggtgac ccggttgccc cgctgaaggc cgtaggcgat       480
     accgacaaaa ccggtaccac catccgattc tggccgagct ctcagatctt ctctgacacc       540
     accttccatt acgacatcct ggccaagcgc ctgcgtgagc tgtcgttcct gaactccggt       600
     gtctccatcc gtctggtgga cgagcgtgat gccaaagagg atcactactg ctacgaaggc       660
     ggtatccacg cctttgttga gttcctcaac cagaacaaga ccccggtgca ccagcaggtg       720
     ttccacttca ccatcgagcg cgaagatggc atcggtgtgg aagtggcgat gcagtggaac       780
     gatggtttcc aggaaaacat ctactgcttt accaacaaca tcccgcagcg ggatggtggt       840
     actcacctgg ctggtttccg tgccgcgctg acccgtacct tgaacaacta catggacaag       900
     gaaggctaca gcaagaaggc caagaccagc gcttccggtg atgatgcccg tgaaggtctg       960
     actgcggtaa tctcggtcaa ggtgccggat ccgaagttct cctcccagac caaagacaag      1020
     ctggtgtcct ccgaggtgaa gaccgcggta gagcagacca tgggtgaaca gctgcaggac      1080
     ttcctgctgg agaacccggg cgacgccaaa accgttgtaa gcaagatcat cgatgcagcc      1140
     cgtgcccgtg aagcggcccg taaagcccgc gagatgaccc gccgtaaagg cgccctcgac      1200
     ctggctggcc tgcccggcaa gctggcggac tgccaggaga aagacccggc actgtccgaa      1260
     ctgtacattg tggagggtga ctctgcgggc ggttccgcca agcagggtcg taatcgtaag      1320
     taccaggcca ttctgccgct gaagggtaag atcctgaacg tagagaaggc ccgtttcgac      1380
     aagatgctct cctctcagga ggtggccacc ctcatcaccg cgatgggctg tggtatcggt      1440
     cgtgacgagt acaacccgga caaaacccgc taccacaaca tcatcatcat gacggatgct      1500
     gacgtggacg gctcccacat tcgtactctg ctgctgacct tcttctaccg tcagatgccg      1560
     gagctgatcg agcgtggcta catctacatt gctcagccgc cgctgtacaa agtgaagaag      1620
     ggcaagcagg agcgctacat caaagatgaa gcggccctga ctgagtacct gaccagcctg      1680
     gctctggaca acgcttcgct gcacgtgaac caggatgccc cgggcatcag cggtgagcac      1740
     ctggagcgac tggtgaatca gtaccgcgaa gttcaggatg tagttgagcg tcaaagccgc      1800
     cgtttcccca agagcctgct caacaagctg gtctacgttc cgggactgtc tgaaggcagc      1860
     ctcaaggaca aagcggagat caccgagtgg actgagcgtc tggtgtctga gctcaacgag      1920
     ctggacctgg aaggggcgac ctaccgctac gaactgcagg aagagagcga gcgtggcctg      1980
     tggctgccta agctggtgct gcgtcagcac ggtgtggaaa gcaactacct gctgaccttc      2040
     gacttcatca actccagcga ctacggccgc attgttgccc tgggcaacgc cattggtgac      2100
     ctgatggagg agggcgctta cgtccgccgt ggcgagcgta ccctgccggt agacagcttc      2160
     gagaagggcc tgacctggct gatgaacgag tccaagcgtg gcctctacat ccagcgctat      2220
     aaaggtctgg gcgagatgaa cccggaccag ctgtgggaaa ccaccatgga tccggaaacc      2280
     cgccgtatgc tgcgcgtgac catcgaagac gccatcggtg ccgatcagct gttcaccacc      2340
     ctgatgggtg atcaggtaga gccgcgtcgc gacttcatcg agaagaatgc gctgttggtg      2400
     gcgaatctgg acgtgtaa                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page