(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE40

CP002209.PE40        Location/Qualifiers
FT   CDS_pept        complement(51763..51957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_03629 hypothetical protein; SPTR:
FT                   Q5V5C7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74254"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA0"
FT                   /protein_id="ADN74254.1"
FT                   /translation="MADKHTTNWPELAAALYDKLCERNAELTYDFANVEVQVPSHSEED
FT                   AQHARWRVNGQISIRARNQ"
     atggctgaca aacacaccac caactggccg gaactggccg ccgcactgta cgacaaactg        60
     tgcgaacgca acgccgaact gacttacgac tttgccaacg ttgaagtgca ggtgccgagt       120
     cactccgaag aggacgctca gcatgcgcgc tggcgggtta acggccagat cagcatccgc       180
     gcccgcaacc agtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page