(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE401

CP002209.PE401       Location/Qualifiers
FT   CDS_pept        443831..444343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0401"
FT                   /product="pilin, putative"
FT                   /note="InterPro IPR000983: IPR012902: IPR001120; KEGG:
FT                   swp:swp_4067 pilin, putative; SPTR: A2UWB0 Prepilin-type
FT                   cleavage/methylation; PFAM: Prokaryotic N-terminal
FT                   methylation motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74615"
FT                   /db_xref="GOA:E1SNB6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB6"
FT                   /protein_id="ADN74615.1"
FT                   /translation="MKRQGFTLVELVIVVVLLAILAAVALPRYLNLGDDAERSRFYATM
FT                   AALESAVDLSHLCWQLRAGEGAVADLDCGGFDEVDFNESGYPVGVLEGGLVSINNDHDC
FT                   LLVFDGIVDTDMKLWSPNDGRAPGVSRDEAQIQSDYVGNGRCRFTLLSDSNEQFEYHSN
FT                   TGQVLAQ"
     atgaagcgtc aagggttcac actggtcgag ttggtgattg tggtggtgtt gctggccatc        60
     cttgcggcgg tggcactgcc gcgctatctc aatcttggcg atgatgctga gcggtcccgg       120
     ttttacgcca cgatggcggc gcttgagagc gcggtggacc tgtcccacct ctgttggcaa       180
     ctgcgtgccg gtgagggcgc cgtggcggat ctggattgcg gtggctttga tgaggtcgac       240
     ttcaacgagt cgggctatcc ggtgggcgtg ttggaagggg gattggtctc catcaacaac       300
     gaccatgact gcctgctggt gttcgatggt attgtcgata ccgatatgaa gctgtggtcg       360
     cccaatgacg gccgtgcgcc gggcgtcagc cgcgatgagg cgcagatcca gtctgattat       420
     gtgggcaacg gaaggtgccg ctttaccctg ctgtccgaca gcaacgagca gtttgaatat       480
     cactccaata ctggccaggt gttagcccaa tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page