(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE402

CP002209.PE402       Location/Qualifiers
FT   CDS_pept        444340..444573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0402"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="COGs: COG3313 Fe-S protein; InterPro IPR010710;
FT                   KEGG: swd:Swoo_3162 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1289; SPTR: A3SXP0 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1289)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74616"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB7"
FT                   /protein_id="ADN74616.1"
FT                   /translation="MTRIESPCVACCKLDEQDVCQGCYRTLAEIANWNRRTEAEKADIL
FT                   ARLPARAEAYRREAEGPTHAITRQAVLAVKEH"
     atgacccgaa ttgaatcccc ctgcgtggcg tgctgtaagc tggatgaaca ggacgtgtgc        60
     cagggctgtt accgtaccct tgctgagatc gccaactgga accggcgcac cgaggcggag       120
     aaggccgata tcctggctcg cctgccggcc cgtgctgaag cctaccgacg tgaggccgaa       180
     ggcccaactc acgccattac ccgtcaagcg gtgctggcgg tcaaagagca ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page