(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE408

CP002209.PE408       Location/Qualifiers
FT   CDS_pept        446649..447263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3247 conserved hypothetical protein;
FT                   InterPro IPR005325; KEGG: mxa:MXAN_3732 hypothetical
FT                   protein; SPTR: A0NLE4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74622"
FT                   /db_xref="GOA:E1SNC3"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC3"
FT                   /protein_id="ADN74622.1"
FT                   /translation="MIKTTLDAALTLGRRSGIFLLILGILSVAMPWATGLALEMLLGIL
FT                   LLCAGVAQLFFAFRTRELSGFPLRLVFGLLTSFAGLYLLFNPTAGVVAITLILGIYFLI
FT                   DGLATLLASFQYRAQRNWLMMFANGAVTLALAAVILWQWPASGRYVIGILVGIKLIMMG
FT                   LMMITTAGMVSAAKDRMDAVRAQQRADGAKVVDGEDRTVDP"
     atgatcaaaa ccaccttgga tgcggccctg acattgggtc ggcgcagcgg tatcttcctg        60
     ttgattctgg ggattttgtc cgtggcgatg ccatgggcaa ccgggctggc gctggagatg       120
     ctgttgggta tcttgctgtt gtgtgcgggt gtggcccagt tgttcttcgc cttccgtacc       180
     cgcgaactgt cagggtttcc gttgcggctg gtgttcggcc tgctgaccag tttcgccggt       240
     ttgtacctgt tgtttaaccc cactgccggg gtggtggcca tcaccctgat cctcgggatc       300
     tacttcctga tcgatggcct ggcgaccctg ctggcgagct tccagtatcg ggcccagcgt       360
     aactggctga tgatgtttgc caatggcgcg gtcaccctgg cgctggcggc ggtgatcctg       420
     tggcaatggc cggcttccgg acgctacgtt atcggcatcc tggtgggcat taagctgatt       480
     atgatggggc tgatgatgat cactaccgcg gggatggtca gtgccgccaa agatcggatg       540
     gatgcggtgc gggcccagca acgggctgat ggagccaagg tggtggacgg cgaagaccgt       600
     accgtcgatc cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page