(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE411

CP002209.PE411       Location/Qualifiers
FT   CDS_pept        449769..450305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74625"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC6"
FT                   /protein_id="ADN74625.1"
FT                   /translation="MRKGWMGLGLLLLTGCMSVPVATMVKMAGFDRQDFLALEPEALRL
FT                   KLTLDQNVPVQLAATRLELGAELDNGQQQLFAGSVRQEEYRQFEVDGGWFSREPEPRYQ
FT                   YLLALDEAGEAAIRDFQRVLTEDEVASASLNVRLDLDDQFDQPVQVTVEVKLSEQEGFF
FT                   TLLDEATFEPERYRD"
     atgcgcaaag gatggatggg gctggggttg ttactgctga cggggtgtat gtcggtaccg        60
     gtggcgacca tggtgaagat ggccggattc gaccggcagg acttcctggc cctggagccg       120
     gaggcactgc ggctgaagct gaccctggat cagaatgtgc cggtgcagct ggcagccacc       180
     cgactggagt tgggggcaga gttggataac ggtcagcagc agttgtttgc tggctccgtg       240
     cggcaggagg agtatcgcca gtttgaagtg gatggcggct ggttcagtcg cgagccggaa       300
     ccacgctacc aatacctgtt ggcgctggat gaggccggtg aggccgccat tcgcgatttt       360
     cagcgggtgt tgacggaaga tgaggtggcg tcggcgagcc tcaatgtccg gctcgatctg       420
     gatgaccagt ttgaccagcc ggtgcaggtg acggtggagg tgaagctgtc ggagcaggag       480
     gggtttttca ccctgctgga tgaagccacc tttgagccgg agcgttaccg ggattaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page