(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE413

CP002209.PE413       Location/Qualifiers
FT   CDS_pept        complement(451657..451881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74627"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC8"
FT                   /protein_id="ADN74627.1"
FT                   /translation="MKSCECGCGEYTAGGKFRPGHDQKLRSRLEAKTGDLLGMRNLVES
FT                   AFAYSQGQMSESDFLSHVRSVFAQQHTPR"
     atgaaaagct gtgaatgcgg ctgcggtgaa tataccgcgg gcggtaaatt cagaccgggc        60
     cacgaccaaa agcttcgttc ccggttagaa gcgaaaactg gcgatctact tgggatgcga       120
     aacctcgttg agagtgcgtt cgcctacagc caagggcaga tgtcggaatc cgacttttta       180
     tcgcatgtcc gcagtgtatt cgctcagcaa cacaccccca gataa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page