(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE414

CP002209.PE414       Location/Qualifiers
FT   CDS_pept        complement(452050..453642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0414"
FT                   /product="IMP cyclohydrolase
FT                   ;phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="COGs: COG0138 AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful); InterPro IPR011607: IPR013982: IPR002695; KEGG:
FT                   vfm:VFMJ11_2512 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; PRIAM: IMP cyclohydrolase; SMART: AICARFT/IMPCHase
FT                   bienzyme formylation region; SPTR: B5FC70 Bifunctional
FT                   purine biosynthesis protein purH; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme; MGS-like domain; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74628"
FT                   /db_xref="GOA:E1SNC9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC9"
FT                   /protein_id="ADN74628.1"
FT                   /translation="MNAPRPIRRALLSVSDKTGIVEFARALSERGVELLSTGGTARLLA
FT                   DSGLNVTEVSDYTCFPEMMDGRVKTLHPKVHGGILGRREQDDAVMDSHGIKPIDMVVVN
FT                   LYPFAQTVAKAGCTLEDAVENIDIGGPTMVRSAAKNHKDVAIVVNAHDYDRVITEMDAG
FT                   EGSLTFQTRFDLAIAAFEHTAAYDGMIANYFGTMVPSYGDNKEGDEESVFPRTFNQQFI
FT                   KKQDMRYGENSHQRAAFYVEKNVQEASVATAVQLQGKALSYNNIADTDAALECVKEFDV
FT                   PACVIVKHANPCGVALGDNILDAYDRAFKTDPTSAFGGIIAFNRELDGDTAKAIVDRQF
FT                   VEVIIAPSISADAKAIVADKKNVRLLACGQWESKTTEFDTKRVNGGLLVQDRDQGMVGL
FT                   DDIKVVSKRQPTAEQLQDLMFCWKVAKYVKSNAIVYAKDGMTVGVGAGQMSRVYSAKIA
FT                   GIKAADEGLTVPGSVMASDAFFPFRDGIDAAAEAGISCVIQPGGSMRDQEVIDAADEHG
FT                   MVMIFTNMRHFKH"
     atgaacgcac cccgcccgat ccgtcgagcc ctgctgagtg tctccgacaa aaccggcatc        60
     gtcgagtttg cccgcgccct ctctgagcgt ggcgtagaac tcctctccac cggcggcacc       120
     gcccgcctgc tggccgactc tggcctgaac gtcactgaag tgtccgatta cacctgcttc       180
     cccgagatga tggatggccg cgtcaaaacc ctgcacccca aagttcacgg tggcatcctg       240
     ggccgtcgcg agcaggacga tgccgtaatg gacagccacg gcatcaagcc gatcgatatg       300
     gttgtggtta acctctaccc cttcgcccag accgtcgcca aagcgggctg caccctggaa       360
     gacgccgtag agaacatcga catcggtggc cccaccatgg tgcgctccgc cgccaagaac       420
     cacaaagacg tggccatcgt ggtcaacgcc cacgactatg accgcgttat caccgagatg       480
     gacgccggtg aaggctccct caccttccag acccgcttcg acctggccat cgccgccttc       540
     gaacacactg ccgcctacga cggcatgatc gccaactact tcggcaccat ggtaccgagc       600
     tacggcgaca acaaagaggg cgacgaggaa tcggtattcc cccgcacctt caaccagcag       660
     ttcatcaaga agcaggacat gcgctacggc gagaacagcc accagcgtgc cgctttctac       720
     gtcgagaaga acgtgcagga agcgtctgtg gccaccgccg tgcagctgca gggtaaagcc       780
     ctctcctaca acaacatcgc cgacaccgat gcagcgctgg agtgtgtcaa agagtttgac       840
     gttccggcct gcgttatcgt caagcacgcc aacccctgtg gtgtggccct gggcgacaac       900
     atcctcgacg cctatgaccg cgccttcaaa accgacccga cctccgcgtt cggcggcatc       960
     atcgccttta accgcgagct ggacggcgac accgccaaag cgatcgtgga tcgtcagttt      1020
     gtggaagtga tcatcgcccc gagcatctcc gccgatgcca aggcgatcgt ggccgacaag      1080
     aagaacgtgc gcctgctggc ctgcggtcag tgggagagca aaaccacaga gttcgacacc      1140
     aagcgcgtca acggtggcct gctggtgcag gaccgcgacc agggcatggt gggtctggac      1200
     gacatcaagg tggtgtccaa gcgtcagccc accgctgagc agctgcagga cctgatgttc      1260
     tgctggaagg tcgccaagta cgtgaagtcc aacgccatcg tgtacgccaa agatggcatg      1320
     accgtgggcg tgggcgccgg ccagatgagc cgcgtttact ccgccaaaat cgctggcatt      1380
     aaggccgccg acgagggcct gaccgtaccg ggttccgtca tggcgtctga cgccttcttc      1440
     ccgttccgtg atggcatcga tgccgccgca gaagcgggca tcagctgtgt gattcagccg      1500
     ggtgggtcga tgcgtgatca ggaagtgatc gatgcagcgg atgagcatgg catggtgatg      1560
     atcttcacca acatgcgcca tttcaaacat taa                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page