(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE417

CP002209.PE417       Location/Qualifiers
FT   CDS_pept        455804..456094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74631"
FT                   /db_xref="UniProtKB/TrEMBL:E1SND2"
FT                   /protein_id="ADN74631.1"
FT                   /translation="MKGIALLATLLAATPALAAESIVYRCGMGNVERIIAVHYPHGETL
FT                   PCEVHYSKPEGSQILWTAQNTEGYCEQRAENFVEKQRGWGWQCNKEVAKPE"
     atgaaaggga ttgccctgct ggccacgctg ttggccgcta ccccggccct ggccgccgag        60
     tccattgtct atcgctgcgg catgggcaat gtcgaacgca ttatcgcggt gcactatccg       120
     cacggtgaaa ccctgccctg cgaagtgcac tacagcaagc cggaaggcag ccagatcctg       180
     tggacggccc agaataccga aggctactgt gagcagcgcg ctgagaactt tgttgagaag       240
     cagcgtggtt ggggctggca gtgcaataag gaagtggcca agccggagtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page