(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE418

CP002209.PE418       Location/Qualifiers
FT   CDS_pept        complement(456149..457045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0418"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="COGs: COG2431 membrane protein; InterPro IPR005642;
FT                   KEGG: aha:AHA_1683 hypothetical protein; PFAM: protein of
FT                   unknown function DUF340 membrane; SPTR: A3GYM4 Membrane
FT                   protein; PFAM: Membrane protein of unknown function
FT                   (DUF340)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74632"
FT                   /db_xref="GOA:E1SNY3"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY3"
FT                   /protein_id="ADN74632.1"
FT                   /translation="MDTLVILSPLVVGYLIPLRHRPTLQLIDRALTAIIYLILGLMGVG
FT                   LGSMDNLAGEIGGILTLTLTLIGLTLVANIAALPLVDKRWPLSLGQQEGEVRTFAMVVE
FT                   SLQLAGVVLAGFMLGLLFPQPSAHIESGVNLILMLLLLLIGIQLRASGMSLRQILLNPR
FT                   GLAIAAAVLGTSLLAGAATAWLWQLPIHHGMALAAGTGWYSLSGALVSAKLGPAMGSVA
FT                   FLADLCRELIAIILIPLMMRRQPATAIGYGGATAMDFTLPIIQKSGGPQTVPIAIVSGF
FT                   VLSLAGPILIPFFLSLG"
     gtggacactt tggttatcct ctccccgttg gtggtcggct accttatccc gctgcgtcac        60
     cgacctaccc tgcagttgat cgatcgcgcc ctgaccgcca tcatctacct gatcctcggc       120
     ctgatgggcg ttggattggg cagcatggat aacctagcgg gtgaaatcgg cggcatcctg       180
     accctcaccc tcaccctcat tggcctgact ctggtggcca acatcgccgc cctgcccctg       240
     gtggacaagc gctggcctct cagtttaggc caacaggagg gggaagttcg caccttcgct       300
     atggtggtgg aatcactgca actggccggg gtggtattgg ccggctttat gcttggcctg       360
     ctgtttcctc agcccagcgc tcatatcgaa tccggcgtta accttatcct gatgctgtta       420
     ctgctgttga tcggcatcca gctgcgcgcc tccggcatga gcctgcgcca aatcctgctg       480
     aacccccgtg gcctggccat tgcggctgcg gtgctgggca ccagcctgct ggctggcgcg       540
     gccaccgcct ggttatggca actgccgatt caccatggca tggcgctggc ggcgggcacc       600
     ggctggtact ctctgtccgg ggcactggtc agcgccaagc tgggcccggc gatggggtca       660
     gtggcgttcc tggcggacct ctgccgggaa ctgatcgcca ttatcctgat cccccttatg       720
     atgcggcgcc aacccgctac ggccatcggt tacggcggcg ccacggcgat ggatttcact       780
     ctgccgatca tccagaaaag cggcggtccg caaaccgtgc ccatcgccat cgtcagtggc       840
     tttgtgctga gtctggccgg cccgatcctg atccccttct tcctgtcgtt aggctaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page