(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE422

CP002209.PE422       Location/Qualifiers
FT   CDS_pept        459350..460108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_2105 hypothetical protein; SPTR:
FT                   Q50658 Uncharacterized protein Rv2307c/MT2364"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74636"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY7"
FT                   /protein_id="ADN74636.1"
FT                   /translation="MAQLGRILLWLVLIYLLLCLAMTLSQRHLLYLPTPKAPASVPALR
FT                   LAGPEGDLVVHPVQPGRANAVFYFGGNAEAVYRSADSLARALPGCTLYLVNYPGYGGSA
FT                   GQPSEATLTAAALSAYDQLSSGHQQLAAIGRSLGSAVALSLAARRPLQRQALLTPFASL
FT                   EALAYEHYPWLPASLLLWDRYDLLALAPAVTSPSLVLLAQQDRVVPLAASSPLLSALKA
FT                   PTIVEVAGTHNRFDATASLAAFFHPICGAL"
     atggcccagc ttggccgcat cttgttgtgg ctggtgctga tctacctgtt gctgtgcctg        60
     gcgatgaccc tgagtcagcg ccacttactg tacctgccaa cgccgaaggc tccggcttca       120
     gtcccggcac tgcgcctggc gggaccggaa ggcgatctgg tggtgcatcc ggtgcagccg       180
     ggccgggcca atgcggtgtt ttactttggc ggcaacgccg aagcggtcta ccgcagtgcc       240
     gacagtctgg cccgggcgct gccgggctgc accctctatc tggtgaacta tcccggctat       300
     ggcggcagtg ccgggcagcc cagcgaagcg accctgacgg cggccgccct gagtgcttac       360
     gatcagctgt catccggaca ccaacagctg gccgcgattg gccgcagcct aggcagtgcc       420
     gtggcgctgt cgttggcggc ccggcggccg ctgcaacggc aggccctgct gaccccgttc       480
     gccagtctgg aagccttggc ttatgaacac tacccttggt tgcctgcctc cctgttgctg       540
     tgggaccgct acgacctgct ggccctagcc ccagcagtga cctctcccag cctggtgctg       600
     ctggcgcagc aggaccgggt ggtccccctt gcagccagtt cgccactgct gagcgccctg       660
     aaggcgccca ccatagtcga agtggcgggc acccataacc gttttgatgc gactgcatcc       720
     cttgccgcgt tctttcaccc catctgtggc gcgctctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page