(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE428

CP002209.PE428       Location/Qualifiers
FT   CDS_pept        complement(463370..463666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0428"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR002942; KEGG: saz:Sama_1264 RNA-binding S4;
FT                   PFAM: RNA-binding S4 domain protein; SPTR: A2V2X7
FT                   RNA-binding S4; PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74642"
FT                   /db_xref="GOA:E1SNZ3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ3"
FT                   /protein_id="ADN74642.1"
FT                   /translation="MSTSVLELHPGDDFIELYKVLKIEGWVGSGSEAKMLIAEGEVLVN
FT                   HEVETRKRRKLVPGDNVIFGEEAVLIQASAKPAPQVDEASKPAKPKRRPSLKF"
     atgtctactt ctgttctgga acttcacccc ggtgacgact ttatcgagct ctacaaagtg        60
     ctcaaaatcg agggctgggt aggttcgggc agtgaagcca agatgctgat cgccgagggc       120
     gaggtgctgg tgaaccacga agtggaaacc cgcaagcgcc gtaaactggt ccccggcgac       180
     aacgtgattt tcggcgaaga ggccgtactg attcaggcca gcgctaagcc ggccccccag       240
     gtggacgagg ccagcaaacc ggccaaaccc aagcgccgcc ccagtttaaa attttaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page