(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE434

CP002209.PE434       Location/Qualifiers
FT   CDS_pept        474446..474988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0434"
FT                   /product="protein of unknown function DUF442"
FT                   /note="InterPro IPR005939; KEGG: spc:Sputcn32_0073
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF442; SPTR: A2UY06 Putative uncharacterized protein;
FT                   PFAM: Putative phosphatase (DUF442); TIGRFAM: conserved
FT                   hypothetical protein TIGR01244"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74648"
FT                   /db_xref="GOA:E1SNZ9"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ9"
FT                   /protein_id="ADN74648.1"
FT                   /translation="MRWFSFAAALTLMPMAHAALPDMTPVQDIRAFQTVSPSLLTAGLP
FT                   MPADFARLHQAGVEVVINLMPDSSNKAYSNEAELVTDAGMVYVAIPVDWQNPTTDDVDA
FT                   FFNVMSRYQDKTVLVHCLANFRASAFVYLYQWAQAEQGDKPEMAAVMAPWGDLEQSLKE
FT                   YPQWAALIEKVKAQRGQ"
     atgagatggt tctctttcgc cgcggcgctg accctgatgc cgatggccca cgccgccctg        60
     ccggatatga ccccggtaca ggacatccgc gcttttcaaa ccgtgtcccc cagcctgctg       120
     accgcgggct tgccgatgcc cgccgacttc gcccgactgc accaggctgg cgtagaggtg       180
     gtgatcaacc tgatgcccga cagcagcaat aaggcgtaca gcaacgaagc ggagttggtg       240
     accgacgcgg gcatggtgta cgtcgccatc ccggtggatt ggcaaaatcc caccaccgac       300
     gacgtggacg ccttctttaa tgtgatgtcc cgttaccagg acaaaaccgt gctggtgcat       360
     tgcctagcca atttccgcgc ctcagccttt gtttatctgt accagtgggc tcaggcggag       420
     cagggcgaca agccggagat ggcggcggtg atggctccct ggggcgacct tgagcagagc       480
     cttaaggagt acccgcagtg ggccgcgctg attgaaaaag tgaaagcgca gcgagggcag       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page