(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE435

CP002209.PE435       Location/Qualifiers
FT   CDS_pept        475350..475886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0435"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="InterPro IPR018550; KEGG: asa:ASA_2673 hypothetical
FT                   protein; PFAM: Lipid A 3-O-deacylase-related; PFAM: Lipid A
FT                   3-O-deacylase (PagL)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74649"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP00"
FT                   /protein_id="ADN74649.1"
FT                   /translation="MKSICLPVISLALLTLSSNAHSLSLLDSRQIQLSGGQPVTEQNVD
FT                   VSTFEIEYQQPLWMIPRYQVGVDWAFGGGTLDTEVENAPMVFSGLGLRWEPWQYLMLRA
FT                   DGKVRYLSEHRFQAEQGRAKDYGGRMQYSYSFSMLLNVQKDLQFGYRYQHMSNGGMYEV
FT                   NPALNTHNLVFGYRF"
     atgaaaagta tttgtttgcc tgttataagc cttgcgcttc ttaccctctc ttctaacgct        60
     cacagcctgt cactgctgga cagtcgccaa atccaacttt ccggcggtca gccggtgacg       120
     gagcagaatg tcgatgtctc caccttcgag attgagtatc agcaaccgct ttggatgatt       180
     cctcgctatc aggtgggggt cgactgggcc ttcggtggcg gcaccctcga taccgaggtg       240
     gagaatgcgc ccatggtatt cagtggcctc ggcctgcgct gggagccctg gcaatacctg       300
     atgctccgcg cggacggcaa ggtgcgctac ctgtctgagc accgttttca ggcggagcag       360
     gggcgggcca aggattacgg cggcaggatg cagtactcct actccttctc catgctgctc       420
     aacgtgcaga aagacctgca gttcgggtac cgataccagc acatgtccaa tggtggcatg       480
     tatgaggtaa atccggcact gaacacccac aatctggtgt ttggctaccg cttttaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page