(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE436

CP002209.PE436       Location/Qualifiers
FT   CDS_pept        complement(475939..477156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0436"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="COGs: COG3562 Capsule polysaccharide export protein;
FT                   InterPro IPR007833; KEGG: ecp:ECP_3027 capsule
FT                   polysaccharide export protein KpsS; PFAM: Capsule
FT                   polysaccharide biosynthesis protein; SPTR: P42218 Capsule
FT                   polysaccharide export protein kpsS; PFAM: Capsule
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74650"
FT                   /db_xref="GOA:E1SP01"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP01"
FT                   /protein_id="ADN74650.1"
FT                   /translation="MNILLLQGPLGPFFRTLGNHLVAEGHNVFHISFNGGDECWRSQGS
FT                   LYRFTSTMKEWPAYFRHFCQQHQIDSVVCYGDCRPYHAKASNICRQLDIAFWALEEGYL
FT                   RPDFVTMELGGVNANSSLYPMRRHLPKFNPKHAFQIKHQAGKTFGSRAWFAIRYHVIKR
FT                   LGVSAYPHFVSHRPWGLLKEALSWVKGGLLKLRFKSIDRAMLQELQAEKGRVFLLPLQV
FT                   SEDFQILSHSNYRDVATVIKEVVGSFARHADSADTLLIKHHPMDRGYINYQPLINQLRE
FT                   QHHLGKRLRFGYELPLPEVYPLLKGVVTVNSTVGLSALLHHLPVKCLGKALYDIPGLTT
FT                   PGPLSSFWRQQQPVCEATFDAVRNALLHQTQINGSFFTLMEETAVEVAQVMVQHHSQQR
FT                   ELRAAS"
     atgaatatcc tgctgttaca aggccccctt ggccccttct tccgcacgct tggcaaccac        60
     ttggttgctg aggggcacaa cgtatttcac atcagtttta acggcggcga tgagtgctgg       120
     agaagccagg gctctctgta ccggtttacc agcaccatga aggagtggcc tgcctacttc       180
     cgccactttt gccaacagca ccagattgat tcggtggtgt gctacggcga ttgccgcccc       240
     taccacgcca aagccagcaa catctgtcgc cagcttgata tcgctttctg ggctctggaa       300
     gagggctacc tgcgtccgga ctttgtcacc atggagctgg gtggcgttaa cgccaacagt       360
     tcgctgtatc cgatgcgacg ccacctgcca aaattcaatc caaaacacgc tttccagatt       420
     aagcatcaag cgggaaaaac ctttggcagc cgcgcctggt ttgccatccg ctaccatgtg       480
     ataaagcgac tcggtgttag cgcgtacccc cactttgtca gccaccgccc ctggggcctg       540
     ctcaaagaag ccctcagctg ggtcaaaggc gggttgctga agctgcgctt taaatccatc       600
     gaccgtgcca tgctgcagga gctgcaagca gagaaagggc gggtgtttct gctgccgctg       660
     caggtctcgg aggacttcca gatcctcagc cactccaact accgcgatgt ggctaccgtc       720
     atcaaagagg tggtgggttc ttttgcccgc catgccgaca gtgctgacac cctgctgatc       780
     aagcaccatc cgatggatcg cggctacatc aactaccaac ccctgattaa tcaactgcgc       840
     gagcagcacc atctgggtaa gcgcctgcgc tttggctatg agctgccgtt gccggaggtt       900
     taccccctgt tgaagggcgt ggtgaccgtc aacagcaccg tagggctgtc tgccctgctt       960
     caccacctgc cggttaagtg cctgggcaaa gcgctgtacg acattccggg gctaaccacg      1020
     cccggccccc tgtcgtcatt ctggcgacag cagcaaccgg tctgcgaagc aacgtttgat      1080
     gcggtacgca acgcgttatt gcatcaaacc cagatcaacg gcagcttctt caccctgatg      1140
     gaggagaccg ccgtcgaagt cgcacaggtg atggtgcagc accacagcca gcagcgggag      1200
     ctgagagccg ccagctga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page