(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE44

CP002209.PE44        Location/Qualifiers
FT   CDS_pept        complement(55109..56818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0044"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /EC_number="4.2.99.20"
FT                   /note="COGs: COG1165 2-succinyl-6-hydroxy-2
FT                   4-cyclohexadiene-1-carboxylate synthase; InterPro
FT                   IPR012001: IPR004433; KEGG: spl:Spea_3971
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; PFAM: thiamine pyrophosphate protein
FT                   TPP binding domain protein;
FT                   PRIAM:2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
FT                   ene-1-carboxylic-acidsynthase; SPTR: A8H9P4
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74258"
FT                   /db_xref="GOA:E1SVA4"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA4"
FT                   /protein_id="ADN74258.1"
FT                   /translation="MNTSHCAELNLLWARLMLEELHRLGVRHLCLAPGSRSTPLTLAAA
FT                   GHDGFQRHTHFDERGLGFAALGLAKASQSPVAIITTSGTAVANLYPAVIEAYQTGVPLV
FT                   VLSGDRPPELIACGANQAIIQPAIFANYARRLDLPTPSLEIPPQTLLAQLDQVMVDLDR
FT                   PLHINCMYREPLYPEGLDAPFETYLTPLSEWRKTAEPWAATPAMSRSALPSADDCCSFA
FT                   QGKGIIVVGTLGPHQQPEQILALARRLGWPILADAQSQLRQAEGVVHHIDQLMHHPKAL
FT                   KLLGKAEHLLLIGGRLLSKRLMSFIAQHPWQAFWHYMGHAENLDPAHLRKRRFVGSLPM
FT                   LAALPWPLLPGSGWADALESYSDEVERLAAEQHDQGALTELSAVRLLSRQLGADQQLFI
FT                   GNSLPIRLFDMLAAPGDAPAIFTNRGASGIDGLLATSCGVAMAEGKPTVLVVGDLSLLH
FT                   DLNSLALARSLTSPLVVMVLNNDGGSIFNMLPVPSDALRQQYYRLGHGFGFEGAASQFH
FT                   LPYQRPDSLDALQQALSEGLQRDGASVIEVVVPPNESAELIVEMARQIRGDD"
     atgaacacct cgcactgcgc cgaattgaac ctgttgtggg cgcgactgat gctggaggag        60
     ttgcaccgcc ttggtgtgcg tcatctctgc ctggcaccgg gttcccgctc caccccgctg       120
     accctggctg cggccggtca cgacggtttc caacgccaca cccatttcga tgaacggggc       180
     ctgggcttcg ccgccctcgg cctggccaaa gccagccaga gcccggtcgc catcatcacc       240
     acctccggca ccgccgtcgc caacctctat ccggcggtga tcgaagccta tcagaccggc       300
     gttccgctgg tggtgctatc cggtgaccga ccgccggagc tgatcgcctg tggtgccaac       360
     caggccatca tccagccagc catctttgcc aactacgccc gtcgtctcga cctgccgacc       420
     ccaagcctgg agatcccgcc gcagaccctg ctggcccagc tcgaccaggt gatggtggat       480
     ctcgaccgcc cgctgcacat caactgcatg taccgcgagc cgctctatcc ggaaggcctg       540
     gacgcgccgt ttgagaccta cctgacaccg ctgagtgagt ggcgcaaaac cgctgagccc       600
     tgggccgcta ccccggccat gagccgcagt gccctgccca gcgccgacga ctgctgcagc       660
     tttgcccagg gcaagggcat catcgtggta ggcaccctgg gccctcacca gcaaccggaa       720
     cagattctgg ctctggcccg ccgactgggc tggcccattc tggccgatgc ccaatcgcaa       780
     ctgcgtcagg ccgagggtgt ggtacaccac atcgaccagc tgatgcatca ccccaaggca       840
     ctgaagcttc tgggcaaagc tgaacatctg ctgctgattg gcggacgtct gctctccaag       900
     cgactgatga gctttatcgc ccagcatccg tggcaggcgt tctggcacta catgggccac       960
     gccgagaatc tggatccggc ccatctgcgc aagcgccgct ttgtcggcag cctgccgatg      1020
     ctggccgccc tgccctggcc actgctgccc ggctccggct gggccgatgc gctggagtcc      1080
     tacagtgacg aagtggaacg gctggccgca gagcagcatg atcagggcgc attgaccgaa      1140
     ctgtccgccg tccgtctgct gtcgcgccaa ctgggcgctg accagcagct gtttatcggt      1200
     aacagcctgc cgatccgcct gtttgacatg ttggcagccc cgggtgatgc cccggccatc      1260
     ttcaccaacc gtggcgcctc cggcattgat ggcctgctcg ccaccagctg tggcgtggca      1320
     atggccgaag gcaaaccgac ggttctggtg gtaggcgacc tgtcactgct gcacgacctc      1380
     aactccctgg cattggcccg cagcctgacc agcccgctgg tggtgatggt gcttaacaac      1440
     gacggcggca gcatcttcaa tatgctgccg gtgcccagtg acgccctgcg tcagcagtac      1500
     taccgccttg gccacggctt tggttttgaa ggggccgcca gccagttcca tctgccctac      1560
     cagcgccccg acagtctgga tgccctgcag caagccctca gcgaagggct gcagcgtgac      1620
     ggtgccagtg tgatcgaggt ggtggtgccg cccaacgaat cggccgagct gattgtggag      1680
     atggcacgcc agatccgggg cgatgactga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page