(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE440

CP002209.PE440       Location/Qualifiers
FT   CDS_pept        complement(480916..483150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0440"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173; KEGG: amc:MADE_00968 putative
FT                   glycosyltransferase family 2 protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: P55465 Uncharacterized protein
FT                   y4gI; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74654"
FT                   /db_xref="GOA:E1SP05"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP05"
FT                   /protein_id="ADN74654.1"
FT                   /translation="MTFFSEAQGWLSPKIQFRLLPKKELQTGQSLDWASTGYDPTFHLK
FT                   HRGAAPKGWYMVSLRITASVPRVTAKLYADYGEGIDEKQALQFSVKSGTLFKRVCLFQD
FT                   RPVRLRLDPCQQPCEFTVEHLAFTKLTERRARALMQKKLQGRRNLGALSSLDSSPLLEQ
FT                   YNQCFDHNLSAITYAQWMSQVEAPTLDSSSLEAIYRKLANKPLISVLLTTYNTEPELLR
FT                   QCIESVQGQRYPHWQLCIADDASSHEPVRELLREFAETDKRIRLVLREKNGHISQASNS
FT                   ALELVNGEFVALLDHDDLLAPHALLMMVKAINDAPEAQFFYSDEDKIDEHNQRSEPHFK
FT                   SSWNRDLFYSHNYITHLAVIQTELVRRIGGFRAGVEGSQDYDLFLRAIGHLGNRQIVHV
FT                   PHVLYHWRAINGSTALSASQKGYTSKAGLKALRDYFNSTNLEIEVTPHRLNNCYQVRWP
FT                   LAEPSPLVSLIIPTRDGYELLKQCISSIRNKTRYSAFEILVINNQSQCPKTLAYFRELE
FT                   QTGQARVVDFDDEFNFSAINNLGVAHARGQIVGLINNDIEVINPDWLDEMVRHASRPDV
FT                   GCVGAKLFYPDGRIQHAGVVLGIGGVAGHAHKYFAGHHNGYHSRLSLVQNYSAVTAAAL
FT                   LVRKSVYLEVGGLEPLLKVAFNDVDFCLKVREAGYRNVWTPFAELYHHESVSRGFEDTP
FT                   EKQARFSNEIRWMEKRWGEVLKSDPCYNPNLSLTHEDFSYNTEPALTPSP"
     atgacgtttt tctctgaggc gcagggttgg ctctccccta aaatccagtt ccgcttgttg        60
     cccaagaaag aactgcaaac cggccagagc ctggattggg catcaacggg gtatgaccca       120
     acctttcacc tgaaacatcg cggcgccgca ccgaagggct ggtatatggt cagccttcgt       180
     atcacggcct ctgtgccgag ggtaaccgcc aagctttacg ccgactacgg cgagggcatt       240
     gatgaaaagc aggcgcttca gtttagcgta aaaagcggca ccctttttaa gcgggtttgc       300
     ctgtttcagg atagacccgt tcgcctgcgc cttgacccgt gccaacagcc ttgtgaattc       360
     acggtagagc acctggcctt taccaaattg accgaaaggc gggcccgggc actgatgcag       420
     aaaaaactgc agggcagacg taaccttggt gcgctctcct ctctggacag ttcccccctg       480
     ctcgagcaat acaaccaatg ctttgaccat aacctgagtg caattaccta cgcacaatgg       540
     atgtctcagg tcgaagcccc gacgttggac agcagcagtc tggaagcgat ctatcgtaag       600
     ttggctaaca agccgctgat ttccgtgctg ctcaccacct acaacacgga acctgagctg       660
     ctacgccaat gcatcgagtc ggttcagggg cagcgctacc cgcactggca gctctgtatt       720
     gccgatgacg cttcaagtca tgagcccgtc cgtgagttgc ttcgtgaatt tgccgaaacc       780
     gataagcgga ttcggctggt ccttcgggaa aaaaatggac acatttctca agccagcaac       840
     tcggcactcg aactggtaaa tggggagttt gtcgccctgc tggatcatga tgacttattg       900
     gcgcctcatg ctctgctgat gatggtgaaa gccatcaatg acgcccccga agcccagttt       960
     ttctactctg acgaagataa gatcgacgaa cacaaccagc gaagtgagcc tcactttaaa      1020
     tccagctgga accgggacct gttctactcc cataactaca tcacgcacct ggccgttatc      1080
     caaaccgagt tggttcgacg gatcggcggg ttccgagcgg gagtcgaagg cagccaagac      1140
     tacgatctgt ttctgagagc cattggtcac cttggcaatc gacaaattgt tcacgtccct      1200
     catgtgcttt accactggcg tgccatcaat ggttcaacgg cactgagcgc ttcacagaaa      1260
     ggctatacct caaaggcggg actcaaagcg ctgcgcgatt actttaactc gaccaatctg      1320
     gaaattgagg tgacaccgca tcgcctcaat aactgctatc aggttcgctg gccgctcgcc      1380
     gagccgtcac cactggtcag cctgatcata cccactcggg atggctatga actgctaaaa      1440
     cagtgcatca gcagcatccg caacaaaacg cgatactccg cattcgagat tctggttatc      1500
     aacaaccaaa gccaatgtcc caaaaccttg gcttactttc gagagctcga acaaaccgga      1560
     caagcgagag tggtcgattt tgatgacgag tttaacttct cagccatcaa caaccttggt      1620
     gtggcgcatg cccggggaca gattgtcggg ttaatcaata acgatattga agtgataaac      1680
     cccgattggt tggatgagat ggttcgtcat gccagtcgtc ccgatgtggg ttgcgtcggg      1740
     gccaagcttt tctatcccga tggtcgtatt cagcacgctg gcgtggtgct tggcatcggt      1800
     ggtgtggctg ggcatgctca caagtacttt gcgggccacc acaacggcta tcactctcgc      1860
     ctgagcctgg tgcagaacta ctcggccgtt accgccgccg cactgttggt tcgaaaatca      1920
     gtctatctgg aagttggggg actggagccc ctgctgaaag tcgcgttcaa tgatgtggac      1980
     ttttgcctca aggtccgcga ggcgggatac cgaaacgtat ggaccccctt tgctgagctg      2040
     taccaccatg agtcggtcag caggggcttc gaagacactc ctgaaaagca ggcccgcttt      2100
     agtaatgaga tccggtggat ggaaaagcgc tggggcgagg tattgaagtc tgacccctgc      2160
     tataacccca atctgagcct gacccacgaa gacttctcat acaacaccga acccgctttg      2220
     acaccgtcac catga                                                       2235
//

If you have problems or comments...

PBIL Back to PBIL home page