(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE443

CP002209.PE443       Location/Qualifiers
FT   CDS_pept        complement(484742..485908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0443"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR011128: IPR014027: IPR014026: IPR001732: IPR 017476;
FT                   KEGG: tau:Tola_2842 nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase ; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; PRIAM:
FT                   UDP-glucose 6-dehydrogenase; SPTR: A3EK13 UDP-glucose
FT                   6-dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
FT                   binding domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain; TIGRFAM:
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74657"
FT                   /db_xref="GOA:E1SP08"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP08"
FT                   /protein_id="ADN74657.1"
FT                   /translation="MKIAIAGTGYVGLSNAVLLAQHHEVTAVDIVPEKVEQINQRISPI
FT                   QDTEIELFLKERLLNLTATLDWKAAYQQADFVVIATPTDYDPVTNYFNTRSVEAVIDNV
FT                   MAVNPNAIMVIKSTVPVGYTAAAKARFGTDNILFSPEFLREGKALYDNLYPSRIIVGER
FT                   SQRAEQFAKLLAEGAVKQDIPTLFTDSTEAEAIKLFSNTYLAMRVAYFNELDSYAEAHG
FT                   LSSRQIIEGVGLDPRIGDHYNNPSFGYGGYCLPKDTKQLLANYQDVPNNLIRAIVDANT
FT                   TRKDYIADSIIRRNPQRVGVYRLIMKSGSDNFRASAVQGIMKRIKAKGIEVVVYEPALD
FT                   DAEFFHSPVINNLEEFKASCDVIVANRLVDDLSDVVNKVYTRDLFGSD"
     atgaaaatcg ccattgccgg cacaggctat gttggcctgt ccaatgcggt gctgctggcg        60
     cagcaccatg aagtgacagc tgttgatatt gttccggaaa aagtcgaaca gattaatcag       120
     cgcatttcgc cgattcagga taccgagatt gagctcttcc tgaaggagcg cctgctcaac       180
     ctgaccgcca cactggactg gaaggccgca taccagcaag ccgactttgt cgtgattgcc       240
     acccctaccg actatgatcc ggttaccaac tacttcaata cccgttcggt agaagcggta       300
     atcgataacg ttatggcggt caacccaaac gccattatgg tcatcaagtc tacggtgcca       360
     gttggttata ctgcggccgc caaagcccgg tttggtacgg acaacatcct gttctctcct       420
     gagttcctcc gtgagggcaa agcgctgtac gacaacctgt acccctcacg gattattgtc       480
     ggtgaacgca gccagcgcgc agaacagttt gccaagttgc tggctgaagg ggcggtcaaa       540
     caagacattc cgactctctt tactgacagc accgaagcgg aagccattaa gctgttctcc       600
     aacacctacc tggcgatgcg cgtggcctac ttcaacgagt tggacagcta tgccgaggcg       660
     catggcctga gcagtcgcca gattattgag ggtgtcggcc tggatccacg tattggtgac       720
     cactacaaca acccctcttt tggttatggc ggctattgtc ttcccaaaga caccaaacag       780
     ctgctggcca actatcagga cgtcccgaat aacctgatcc gggccatcgt cgatgccaat       840
     accacccgaa aagactacat cgcggattcc atcatccgac gtaaccctca gcgcgtcggt       900
     gtctatcgcc tgatcatgaa atccggttca gacaatttcc gggcctctgc ggtgcagggc       960
     atcatgaagc ggattaaagc caagggcatt gaagttgtgg tgtatgagcc agcgttagac      1020
     gatgcggaat tttttcattc gccggttatc aacaacctcg aagagttcaa agccagctgt      1080
     gatgtgattg tggccaaccg gctggtcgat gacctgtcag acgtggtcaa caaggtatac      1140
     acccgagacc tttttggtag cgactaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page