(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE444

CP002209.PE444       Location/Qualifiers
FT   CDS_pept        complement(485982..487919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0444"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296: IPR001173; KEGG: mpt:Mpe_A0613
FT                   glycosyltransferase involved in cell wall biogenesis-like
FT                   protein; PFAM: glycosyl transferase family 2; glycosyl
FT                   transferase group 1; SPTR: A3W6W3 Glycosyltransferase;
FT                   PFAM: Glycosyl transferases group 1; Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74658"
FT                   /db_xref="GOA:E1SP09"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP09"
FT                   /protein_id="ADN74658.1"
FT                   /translation="MSVVIPTLVCDEKFEFAFNSLRGQTSENNEILVVVDNSIACNRVS
FT                   HGVRPLINFVNLGAYGARNQGLKHATGDFITVHDADDWSHPQKLEMQVKALLDNPKAMA
FT                   SVSHWARCTTDMQFETRPDGSVVHRNISSLMIRREVFERLGYWDRVSVNADTEYYYRIL
FT                   AAYGPDSIVEVMPGRPLALGRRHEGSLTMQPETHWKTQFGGVRKDYMDAAHKWHKECAK
FT                   TGNWYMPFAPKERPFPVPELIDRAVIELGEKVWPHIRAKQAPKDGSPCILLCGHAAAEQ
FT                   QFGAERSLLDLAKAIDACGYRLVLTLPERQNHYIEQLKPYCSDIVLLPAPWREDDEVWD
FT                   IAVDAYQRLINHFNIDLIHVNTVVHRTPLLAAKRQGTKSVLHVRELLSSDSALQAAMGQ
FT                   SNQTSTEPTDMADLVLANSHYTAEQLAHRRDAKNGDRLDTQIRVLTNTVELSKAWQPKA
FT                   FSLGDPIRVGMISSNLPKKGIADFIRVAQGALDASLALQFYLIGPRNEHIDSLSHGLPS
FT                   NVALIDYSPGPDAALAHIDLLLNLSLFQETFGRTVAEAMLAAKPVITYRWGALPELVNN
FT                   GCNGFLVHLGDVEGVVSRLAYLCDHPDQIYQFGQEGQAMAQTRFTPKRFRDELAQVYQS
FT                   LLGVSTPVTH"
     gtgtcagttg taattccgac tttggtttgc gatgaaaagt ttgagttcgc atttaattca        60
     ttacgaggcc aaacttcaga aaataatgaa atattagttg tagtagacaa ttcgattgca       120
     tgtaataggg ttagccatgg ggtgcgtcct cttataaatt ttgtgaacct tggggcatat       180
     ggcgcccgta accaaggtct caagcacgct actggcgatt tcattacagt ccatgatgct       240
     gatgattggt cccacccaca gaaactggag atgcaagtta aggcattgct ggacaacccc       300
     aaggcaatgg ccagcgtttc ccactgggca cgctgcacca ccgatatgca gtttgaaacc       360
     cgtcccgatg gcagtgtggt gcatcgcaat atctcctcgc tgatgatccg tcgcgaagtg       420
     ttcgagcgcc tgggctattg ggaccgagtg tccgtcaacg cggatactga atattactac       480
     cgtatcctcg cggcctatgg ccctgacagc attgttgaag tgatgccagg caggccactg       540
     gctctggggc ggcgccatga aggcagctta accatgcagc cggaaaccca ttggaaaacc       600
     caatttgggg gtgtgcgcaa agactacatg gatgcggcgc ataaatggca taaggagtgt       660
     gcaaaaacgg gcaattggta tatgcccttt gcccccaaag agcgcccatt cccggtgcct       720
     gagctgattg atcgtgctgt tatcgagtta ggcgaaaagg tttggccaca cattcgggcc       780
     aaacaagcgc caaaggatgg atctccgtgc attttgctct gcggccatgc cgccgcagag       840
     caacagtttg gcgcagaacg cagtcttttg gatctggcca aagcgattga tgcctgcggt       900
     tatcgactgg tcctgactct gcctgagcgg caaaatcact atattgagca gctgaaaccc       960
     tattgcagtg acatcgtgtt actgcccgcc ccatggcgtg aggatgatga agtttgggat      1020
     atcgcggttg acgcctatca acgccttatc aaccacttca acatcgattt gattcacgtc      1080
     aatacggtgg tgcaccgcac gccgctgctg gcagccaaac ggcaaggcac caaaagcgta      1140
     ttgcatgtgc gtgagctgct cagctcagat tccgcattgc aggcagcaat gggccagtca      1200
     aaccaaacca gcaccgagcc aacggatatg gcggatcttg tgctcgcaaa ttctcactat      1260
     accgccgagc agttagctca ccgcagagac gcaaaaaatg gtgatcgatt agacactcaa      1320
     atccgggtac tcaccaatac cgtcgaactg agcaaagcat ggcaacccaa agctttcagc      1380
     ttgggtgatc ccattcgagt cggcatgatc agcagcaacc tgccgaaaaa gggcattgcg      1440
     gactttatcc gtgtggcaca aggggcactc gacgcttcac tggccctaca gttttatctg      1500
     attggtcccc gtaacgagca tatcgattca ttaagtcatg gcttacccag taatgtggcc      1560
     ctaatcgatt acagtccagg tcccgacgcc gcactggctc atatagacct attgcttaac      1620
     ctttctctgt ttcaggaaac ctttggccga accgttgcgg aagcgatgtt ggccgccaag      1680
     cccgttatca cctatcgatg gggtgccttg ccagagctcg tcaacaatgg atgcaatggc      1740
     tttttggtgc acctcgggga cgtagagggc gtcgtctcca gactggccta tctttgcgac      1800
     catccggacc agatctatca gtttggccag gagggccagg ccatggccca aacccgtttc      1860
     accccaaagc gctttcgcga tgaactggct caagtttacc agtctctgct gggcgtcagc      1920
     acaccagtaa ctcactga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page