(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE448

CP002209.PE448       Location/Qualifiers
FT   CDS_pept        complement(493115..494779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0448"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   pol:Bpro_4938 polysaccharide export protein; PFAM:
FT                   polysaccharide export protein; Soluble ligand binding
FT                   domain; SPTR: Q03961 Polysialic acid transport protein
FT                   kpsD; PFAM: Polysaccharide biosynthesis/export protein;
FT                   SLBB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74662"
FT                   /db_xref="GOA:E1SP13"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP13"
FT                   /protein_id="ADN74662.1"
FT                   /translation="MHNSILAKLALAGALSVLPLSTTFAAITFQQDVEAEQVETMSTAK
FT                   VPSQRYGSWLFNGAFSQHSFSATNPEYRLTQGDTLIVQVWGAINHQAEVVVDPQGNIFI
FT                   PKVGPIKVLGVSNAKLNEVIFKSVQRVYQANVEVYASLMSSQKVKVFLSGMVNQPGLYE
FT                   GQSADSVLRFIDQASGIRDDIGSYRNIQVKRNGRLVQQLDLYQFLQSGTLPPMQLQDGD
FT                   VIFVGPKQGEITLEGEVGFQGYYELLANGNKANPLKPILDAVVAGEQATHVTIVAPEAG
FT                   ASSAGNRRVNATQYQIEDAGTIQVSPGALVKVTAQLRPNSISIDLIGEHDSAQEMVLPW
FT                   GASLQDLLDQTQFTRLSNQSAVQLYRESVAERQYEMLQASLSALEQSVLNTRSNTREAA
FT                   ELRAAEAEVILRWIEKARQVQPKGQVLLSESSDFSQIILQQGDKVVIPAKRNLVIVHGE
FT                   VMFPTAIAYRDDLSVLDLINKAGGANQELDEMNILVMKPNGSFVTANKMLKKRDVIAPG
FT                   DEIFVLSKPDEKSMQFAKDITQIIFQVAMSAAVVLSI"
     atgcacaact ccattctggc caaactggct ctggcgggcg ccttgagcgt cctgcccctt        60
     tccaccactt ttgctgccat tacctttcaa caggacgtgg aagcggagca ggtggagacc       120
     atgtcgaccg ccaaggtgcc cagtcagcgt tatggcagct ggttatttaa tggcgccttc       180
     agccaacact ccttctccgc caccaacccg gagtaccgtc tgacccaggg cgataccctg       240
     attgtgcagg tttggggtgc catcaaccat caggccgaag tggtggttga ccctcagggc       300
     aacatcttta tccccaaggt tggccccatc aaagtgctgg gagtcagcaa cgccaaactg       360
     aacgaagtga tctttaaaag cgtacagcgg gtgtatcagg ctaatgtaga ggtgtatgcc       420
     tcgctgatgt cgagccagaa ggtcaaagtg ttcctgtccg ggatggtcaa ccagcctggc       480
     ctgtatgagg ggcaaagcgc ggacagcgtg cttcgcttta tcgaccaggc cagcggcatt       540
     cgtgacgaca tcggcagcta ccgcaatatt caggtcaagc gcaatggtcg cctggtgcag       600
     caactggacc tctaccagtt cctgcaatcc ggcaccctgc caccgatgca gcttcaggac       660
     ggcgacgtca tttttgtggg ccccaaacag ggcgaaatca ccctcgaagg agaagtgggg       720
     tttcaggggt actacgagtt gctcgccaac ggtaataagg ccaatccgct caaacccatc       780
     ctggacgcgg tggtcgctgg ggagcaagcc acccacgtca ccatcgtggc gccggaagcc       840
     ggagcctcct cagccggcaa ccgccgcgta aacgccaccc agtaccagat tgaagacgcc       900
     ggaacgattc aggtatcccc cggcgccctg gtgaaggtaa ccgcgcagtt acgccccaac       960
     tccatcagca tcgacctgat tggcgagcac gactctgccc aggagatggt gctgccatgg      1020
     ggcgccagcc tgcaggacct gctggaccaa acccaattta cccgcctctc caaccagagc      1080
     gcggtgcagc tttatcgtga atccgtcgcc gagcgccagt acgagatgct gcaggcctct      1140
     ctctctgcgt tggaacaatc ggtacttaat acccgttcca atacccgtga agcggccgaa      1200
     ttgcgggctg ccgaagcgga agtgattctg cgctggattg agaaggcgcg acaggttcaa      1260
     cccaagggtc aggttctgct cagcgagagc agcgacttta gccagatcat cctgcagcag      1320
     ggcgacaagg tggtgatccc cgccaagcgc aacctggtga ttgtgcatgg agaggtgatg      1380
     ttccccaccg ccatcgccta ccgggatgac ctctcagtgc tggacctgat caataaagcg      1440
     ggcggcgcca atcaggaact ggatgagatg aacatcctgg tgatgaagcc caatggcagc      1500
     tttgtcaccg ccaacaaaat gctgaaaaag cgcgatgtga ttgcgccggg cgatgaaatt      1560
     tttgtgctct ccaagcccga cgagaagagc atgcagtttg ccaaggacat cactcagatc      1620
     atcttccagg tggcaatgtc agcggccgta gtactcagta tctaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page