(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE450

CP002209.PE450       Location/Qualifiers
FT   CDS_pept        complement(495991..496671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0450"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003439: IPR003593: IPR017871; KEGG: fph:Fphi_1159
FT                   putative capsule polysaccharide export transport system
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: P24586 Polysialic acid transport
FT                   ATP-binding protein kpsT"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74664"
FT                   /db_xref="GOA:E1SP15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP15"
FT                   /protein_id="ADN74664.1"
FT                   /translation="MIRFDNVSKFYPTKSGRHYVLRDVNLELPTDRNIAILGPNGVGKS
FT                   TLIRLMGGADIPNRGQISSDQNISWPLGLQGGLQGSMTARENVRFVARIHGYKDTKPIE
FT                   RRVEEFAEIGKYFDEPVKSYSSGMRSRITFGLTMAFDFDFDVLLIDELGAVGDANFRNK
FT                   SEALLQSKFERTKLIMVSHSLKELKTYCQSGLVLINQQLHYFEHLNDAITLYQDTYVKP
FT                   ISKA"
     atgatccgct ttgacaacgt cagcaagttc taccccacca aatccggtcg gcattacgta        60
     ctgcgggatg tgaatctgga actgcccacc gaccgcaata tcgcgattct cggccccaac       120
     ggtgttggca aatccactct gatacggctg atgggcggcg ccgatatccc caaccgggga       180
     cagatcagtt cagaccagaa catctcctgg ccgctcggcc tgcagggggg gctccagggc       240
     tcaatgaccg cccgcgaaaa tgtacgcttt gtcgcccgca ttcacggcta caaagacact       300
     aaacccatcg agcggcgagt tgaggagttt gccgagatcg gcaagtactt tgatgagccg       360
     gtgaagtcct actccagcgg catgcgctcc cgcatcacct tcggcctcac catggccttt       420
     gattttgatt tcgatgtgct gctgatcgat gagcttggcg ccgttggcga tgccaacttc       480
     cgcaataaga gcgaagcctt actgcaaagc aaatttgagc gcaccaagct gatcatggtc       540
     agccactcgc ttaaagagct caaaacatac tgccagtctg ggttagtgct aataaaccaa       600
     caacttcact acttcgaaca cctgaacgac gccatcaccc tttatcagga cacctatgtc       660
     aaacccatca gcaaagcctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page