(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE451

CP002209.PE451       Location/Qualifiers
FT   CDS_pept        complement(496668..497474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0451"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR013526: IPR013525: IPR000412; KEGG: ebr:ECB_02828
FT                   polysialic acid transport protein KpsM; PFAM: ABC-2 type
FT                   transporter; SPTR: P24584 Polysialic acid transport protein
FT                   kpsM; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74665"
FT                   /db_xref="GOA:E1SP16"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP16"
FT                   /protein_id="ADN74665.1"
FT                   /translation="MNTTNTLIRPPKRSHWQITCDVVFALIIRELKTRFGANRLGYFWA
FT                   LAEPIAQAGIMVLIFTLLGRNSISGVPVALFMLVAILPFKFFSKLVPQLTAAVEANKGL
FT                   LSYRQVTAADPILSRVIIETVTFLVVYLLLMATLAWLNFSVVPENLLALLGVSALVLML
FT                   ALGLGLMLCSAVTYWKDTGKVVAMVMQPMFFISGIFFCATMIPQQYWYLFSWNPLFHVT
FT                   ELSRDAYFSAYTTPVGSWEYLGLWAFSCFTLGLMTFRVCQQRFITS"
     atgaacacaa ccaacactct tatccgcccg cccaagcgca gccattggca gatcacctgt        60
     gatgtggtgt ttgccctcat catccgggaa ctgaaaaccc gctttggcgc caaccgactg       120
     ggctactttt gggccttggc ggagcctatt gctcaagccg gcatcatggt tcttatcttc       180
     actctgctag gacgcaatag catttctggc gttcctgtcg ccttgtttat gctggtggcc       240
     attctgccct ttaagttttt cagcaaactg gtgccacaac tcactgcggc cgtcgaagcc       300
     aacaaaggat tgctgagcta ccgccaggta acggcagcgg accccatcct cagccgcgtc       360
     attattgaaa ccgtgacgtt tttggtggtg tacctgttat tgatggcgac cctggcctgg       420
     ctgaacttta gcgtcgtacc ggaaaatctg ctggcgctcc ttggggtcag cgcgctcgtg       480
     ctgatgttgg cgctgggatt gggactgatg ctgtgcagcg ccgtcaccta ctggaaagac       540
     accggcaaag tggtggccat ggtaatgcag ccgatgttct ttatctccgg catattcttc       600
     tgcgccacca tgattccgca gcagtactgg tacctgttca gctggaatcc cctgttccat       660
     gtcactgagc tcagccgtga cgcctacttc agcgcctaca ccaccccggt aggcagttgg       720
     gagtacctgg gactctgggc gttcagctgt tttactctgg ggttgatgac ctttcgggtg       780
     tgtcagcaga ggtttatcac ctcatga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page