(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE454

CP002209.PE454       Location/Qualifiers
FT   CDS_pept        complement(499907..500794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0454"
FT                   /product="(LSU ribosomal protein L11P)-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG2264 Ribosomal protein L11 methylase;
FT                   InterPro IPR013216: IPR007848: IPR013217: IPR010456: IPR
FT                   004498; KEGG: vpa:VP2883 ribosomal protein L11
FT                   methyltransferase; PFAM: ribosomal L11 methyltransferase;
FT                   Methyltransferase type 12; methyltransferase small;
FT                   Methyltransferase type 11; SPTR: Q87KU2 Ribosomal protein
FT                   L11 methyltransferase; TIGRFAM: ribosomal protein L11
FT                   methyltransferase; PFAM: Ribosomal protein L11
FT                   methyltransferase (PrmA); TIGRFAM: ribosomal protein L11
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74668"
FT                   /db_xref="GOA:E1SP19"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP19"
FT                   /protein_id="ADN74668.1"
FT                   /translation="MAWIQIRLNATNETAETISDELMELGAASVTFVDAQDTPVFEPLP
FT                   GETRLWGDTDVIGLFDAVTDMAPVIDALKAMPELAQQMTYKVEALEDKDWEREWMDNFH
FT                   PMQFGRRLWICPSWREAPEPDAVNVMLDPGLAFGTGTHPTTALCLTWLDGLELGDKSVV
FT                   DFGCGSGILAIAAIKLGAQSVVGLDIDPQALTASADNAQRNGVEEKLTVYLPKNQPDDL
FT                   QADVVVANILAGPLRELAPVISALVKPGGQLALSGLLVEQAEELRAIYGQWFDLNPTAI
FT                   EGDWCRLDGQKRID"
     atggcctgga tccagatccg ccttaatgcc accaatgaaa ccgccgaaac catcagcgac        60
     gaactgatgg aactgggcgc ggcctccgtc acctttgtcg atgcccagga caccccggtg       120
     ttcgaaccgc tgccgggcga aacccgcctg tggggcgata ccgacgtgat tggcctgttc       180
     gacgccgtca ccgacatggc gccggtgatc gacgccctga aggcgatgcc ggaactggcc       240
     cagcagatga cctacaaagt ggaagcgctg gaagacaagg actgggagcg cgagtggatg       300
     gacaacttcc acccgatgca gtttggccgt cgcctttgga tctgcccctc ctggcgtgaa       360
     gcgccggagc cggatgccgt caacgtgatg ctggacccgg gcctggcctt tggtaccggc       420
     actcacccca ccaccgccct gtgcctgact tggctggatg gcctggagct gggcgacaag       480
     tccgtggtcg acttcggttg tggctccggc attctggcca tcgccgccat caaactgggc       540
     gcgcaaagcg tggtgggcct ggatatcgac ccgcaggccc tgaccgcttc tgccgacaac       600
     gcccagcgta acggcgtcga agagaagctg accgtgtacc tgcccaagaa ccagcccgac       660
     gacctacagg ccgacgtggt ggtggccaac atcctggctg gcccgctgcg tgaactggcc       720
     ccggtgatca gcgccctggt gaagcccggc ggccaattgg ccctctccgg cctgctggtg       780
     gaacaggccg aagagctgcg tgccatctac ggccaatggt tcgacctgaa cccgaccgca       840
     atcgaaggcg actggtgtcg tctcgacggc cagaagcgga tcgactaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page