(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE456

CP002209.PE456       Location/Qualifiers
FT   CDS_pept        501816..502520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0456"
FT                   /product="Fumarate reductase respiratory complex"
FT                   /note="InterPro IPR018956; KEGG: shn:Shewana3_0401 fumarate
FT                   reductase cytochrome b-556 subunit; PFAM: Fumarate
FT                   reductase respiratory complex; SPTR: A2UYL7 Fumarate
FT                   reductase respiratory complex, transmembrane subunit; PFAM:
FT                   Succinate dehydrogenase/Fumarate reductase transmembrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74670"
FT                   /db_xref="GOA:E1SP21"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP21"
FT                   /protein_id="ADN74670.1"
FT                   /translation="MFKLSPFGRGPAIMDGLQGLSGALLALFLLLHLHLEASILIGPEA
FT                   FDAVAWFLHAGWADPAGHGYAAMVVAASLVILTLLALHVWTALRRVPIQFRQWRALSRH
FT                   LHWVHHSGTRWWLVQLVTGMALMIFLPVHLITMMTQPHQISVELSALRIVNEGGWLLYG
FT                   VLLPLAVLHGVIGLARLALKWLPSFTGRQGLRRITAVVVVYLLVLGGVSLAAHIDNGQR
FT                   LNDGQSLSVQSR"
     atgtttaaac tctctccctt tggccggggg cccgccatta tggatgggct ccaggggctt        60
     agcggcgcgc ttttggcgct gtttctgctg ctccacctgc accttgaggc cagcattctg       120
     attggccctg aggcgtttga tgccgtggcc tggttcctcc atgccggttg ggctgacccc       180
     gccgggcacg gttatgccgc catggtggtg gccgccagtc tggtgatcct gactctgttg       240
     gccctgcacg tctggaccgc cctgcgccgt gtgccgatcc agttccgcca gtggcgggcg       300
     ctgagccgcc acctgcactg ggtacatcac tccggcaccc gctggtggct ggtgcagctg       360
     gtgacgggca tggcactgat gatcttcctg ccggtgcacc tgatcaccat gatgacccaa       420
     ccccaccaga tcagcgttga gctgtcggcg ttgcgcatcg tcaatgaggg cggctggctg       480
     ctctatggcg tgctgctgcc actggcggtg ttgcacggcg tgattggtct ggcccgtctg       540
     gcactgaaat ggttgcccag ctttaccggt cgccaggggc tgcgccgcat caccgccgtg       600
     gtggtggtgt acctgctggt gttggggggc gtcagcctcg ccgcccacat cgacaatggc       660
     cagcgtctga acgacggcca atccctctcc gttcaatcga gataa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page