(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE458

CP002209.PE458       Location/Qualifiers
FT   CDS_pept        504487..505221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0458"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterPro IPR001041:
FT                   IPR006058: IPR004489; KEGG: lhk:LHK_02342 succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: ferredoxin; PRIAM: Succinate dehydrogenase; SPTR:
FT                   A2UYL4 Succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74672"
FT                   /db_xref="GOA:E1SP23"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP23"
FT                   /protein_id="ADN74672.1"
FT                   /translation="MSARTLIFEIFRFDPQLPGDKPRTERFELEETPGMTVFIALNRLR
FT                   EEQDRSLQFDFVCRAGICGSCAMVINGKPTLACRTLTSTFSSPIITLMPLPGFELIGDL
FT                   SVNTGKFMRALSERVGAWLHPTDAKPCINALEAPMDPAEAEAIYEADRCVECGCCVAGC
FT                   ATAQMRETFIAAVGFNKVARFALDSRDARKPDDFYHIIGDEDGVFGCMTLLGCHDNCPK
FT                   DLNHQAQIAYLRRQLLRGSRIL"
     atgagcgccc gtaccctgat ctttgagatc ttccgatttg atccccagct gccgggcgat        60
     aagccgcgca ccgagcggtt tgagctggag gaaaccccgg gcatgacggt gtttatcgcc       120
     ctcaaccgcc tgcgggaaga gcaggaccgc tcgctgcagt tcgactttgt ctgccgcgcc       180
     ggcatctgtg gcagttgcgc catggtgatc aacggcaaac cgaccctggc ttgccgcacc       240
     ctgaccagca ccttcagcag ccccatcatt actctgatgc cgctgccggg ctttgagctg       300
     attggcgacc tgtcggtgaa caccggcaag tttatgcgtg cgctgtctga gcgggtgggt       360
     gcctggctgc acccgaccga cgccaagccc tgcatcaatg cgctggaagc accgatggac       420
     ccggcggaag ccgaagcgat ctacgaggcg gaccgttgcg tggaatgcgg ctgttgcgtg       480
     gccggttgtg ccactgcgca gatgcgggaa acctttatcg ccgcggtggg attcaacaag       540
     gtggcgcgtt ttgcactgga cagtcgcgat gcgcgcaaac cggatgattt ctaccacatc       600
     atcggcgatg aagacggcgt gttcggttgc atgaccctgc tgggttgtca cgacaactgt       660
     ccgaaagacc tcaaccacca ggcccagatc gcctacctgc gccgccagtt gctgcgcggc       720
     tcccgcatcc tctaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page