(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE462

CP002209.PE462       Location/Qualifiers
FT   CDS_pept        complement(510798..513374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2521 hypothetical protein; SPTR:
FT                   A1HQI0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74676"
FT                   /db_xref="GOA:E1SP27"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP27"
FT                   /protein_id="ADN74676.1"
FT                   /translation="MSRLPLILLPRPESADPSGRPRGGGSIRTPSVTQQYQRLGPQFTR
FT                   LEQALSARRLEIANTAPGIEPEYTVVIETYGHVSEFFRAIQRIPGLEWLGENELEGLEP
FT                   NDDFQDERNAEKPMSGRTMLVLSDRRAIDELLSLWKGYGNDPTMQFARGWAKFRDVFDT
FT                   LKDIRYWSVEDRLHDTGVIEYWQEELEYAPDQPVRFEAELWFRADVYKRADSQARIESQ
FT                   VNQLGGQVVSNCCIEGIAYHSLLVELPAIHVERILDDADVTLVKSDEVMLFRPIGQMCT
FT                   IGGDEVEPEELNIEAPASDAMRDTPRVALLDGLPLANHVYLEGKLRIDDPESFEDSYQA
FT                   NQRLHGTAMASLIVNGDLREAGAPLSSPLYVRPILKPDQRTLGGVETLPADYLPVDLIH
FT                   RAVKRMFEGEGEEEPVAPTVKVINLSIGDPNLHFNGTMSPLARLVDWLSEEYNVLFCVS
FT                   AGNHSQALRLDMESRAFRDLSEEQQHIEAFRAAQLDTRNRKLLSPAESINALTIGATHA
FT                   DASEVNLLAGKLELYTNEMPALYSAHGNGYRRSIKPDLMLPGGRVIHDEPIGLGDATLR
FT                   GLWGSRSAPGLMVPFPHDGGSLCKTVYSRGTSNANAIATRSCAQVCDALELLFEEHNRQ
FT                   GSFEQFAPVLIKALVAHGAGWGDIYGHISEAFPEANRTKLKSLVSQHIGYGKPDVSKSI
FT                   YCLDNRATVLGFGGLVGGEAHEYQLPIPIELGGVELWRKLTVTLAWFAKPSPRNIKYRG
FT                   SALWATLEGENREFATERTYDWLQVRRGTLHHEVFEGEDISVLAGQSELTVKVNCKDDA
FT                   TSTAEPVKYGLAITLEVAEGEDVEIYEEIKERINVKIREQAPLLAR"
     atgagtcgtc ttcctctgat actgcttccg cgcccagaat ctgcagaccc aagtggtcgt        60
     ccccgaggcg gaggaagcat aagaactcca tccgttaccc agcaatacca gaggctagga       120
     ccacaattca caagattaga gcaggcactt tcagcaagaa gattagaaat tgccaatact       180
     gctcctggaa ttgagccaga gtatacggtt gtaattgaga catatggcca tgttagtgag       240
     tttttcagag ctatccaaag aatccctgga cttgaatggt taggtgaaaa cgagttagag       300
     ggacttgaac caaacgacga cttccaagat gaaagaaacg cagaaaagcc tatgtctgga       360
     aggacaatgc tggttctttc tgacagacga gccatcgatg agttacttag cttatggaag       420
     ggctacggca atgatccaac aatgcaattt gctcgaggtt gggcaaagtt tagagatgtt       480
     ttcgatacac taaaggatat tagatactgg agtgtcgaag accgattgca cgatactgga       540
     gtaatagagt actggcagga agagctagag tatgcgccag atcagccagt aaggttcgaa       600
     gctgagcttt ggttcagagc ggacgtatat aaaagggctg acagccaagc aagaattgag       660
     tcccaagtaa atcaattggg gggacaagtt gtttctaatt gctgcattga aggaattgct       720
     tatcactctc tgcttgttga gttgccagct atccacgttg aaagaatact tgatgacgca       780
     gatgtaacct tagtgaagag cgacgaggta atgcttttcc gtcccatcgg gcaaatgtgt       840
     acgattggcg gagatgaagt tgagcccgaa gaactgaaca ttgaggcacc ggcatccgat       900
     gcaatgcgag atactcctag ggttgctttg ttggacgggc tacctttggc gaaccatgtt       960
     taccttgaag gtaagcttcg cattgatgac cctgagtcat ttgaagactc ctaccaagcc      1020
     aatcagcgcc tacatgggac cgctatggct tcgctaatcg tcaacggaga ccttcgtgaa      1080
     gctggggccc cactctcttc ccccctgtat gtgaggccaa tactaaagcc agaccaaagg      1140
     actttggggg gcgtagaaac cctccccgca gattacctcc ccgtcgactt gatacatcgt      1200
     gctgtgaagc gaatgttcga gggagaaggc gaggaagaac ctgtcgcccc aaccgtcaag      1260
     gtaataaatc tatctattgg tgatcctaac cttcacttca atggaacgat gagtccttta      1320
     gctcgtttag ttgactggct gagtgaggag tacaatgtac ttttctgtgt cagtgccggt      1380
     aaccattcac aagctcttcg cctagacatg gaatcacgtg cgttccgaga tttatccgaa      1440
     gaacagcagc atattgaagc atttcgcgcg gcgcagttgg ataccaggaa ccgcaaatta      1500
     ctctctccag ctgaatctat taatgctctg acgattggcg ccacgcatgc agatgcctcg      1560
     gaagttaact tacttgctgg gaagctcgag ctttacacaa atgaaatgcc agctttgtac      1620
     tctgctcacg gaaatggcta ccgcagatca ataaagccag acctgatgtt accaggtggt      1680
     agagttatcc atgacgagcc aattgggttg ggtgacgcta ctttgcgtgg actttggggt      1740
     agccgttcag cacccggatt gatggttcct ttcccgcacg atggggggtc gctctgcaag      1800
     actgtgtata gcagaggcac tagtaatgcg aatgccattg cgaccagaag ttgcgctcaa      1860
     gtctgtgatg cgctggagtt gctcttcgaa gaacataata gacagggaag cttcgaacag      1920
     tttgccccag tcctgattaa ggctttagtc gctcatggcg ctgggtgggg tgatatttat      1980
     ggtcatattt ctgaagcgtt tcctgaggcc aatagaacaa agctcaaatc tctggtatct      2040
     cagcacattg ggtatggaaa accagatgta tctaaatcga tctattgcct cgacaatcgg      2100
     gcgacagtac tcgggtttgg cggcttggtt ggtggtgaag cccacgagta ccagctcccc      2160
     atacctatag agcttggtgg ggttgagctg tggcgaaaac tgacagtgac acttgcatgg      2220
     tttgccaaac ctagcccgag aaacatcaag tacagaggta gtgctctatg ggcaaccctt      2280
     gaaggagaga acagagagtt tgctacagaa cgtacatatg attggctaca agttcgccgt      2340
     ggcacgcttc atcacgaagt tttcgagggc gaagacatca gcgtactagc aggccaaagc      2400
     gagcttacag taaaggtaaa ctgtaaagat gacgctacct ctactgccga acccgtgaag      2460
     tatggcttgg caattacgct cgaagtggca gaaggggaag atgtagaaat ctacgaagag      2520
     atcaaagagc ggataaacgt gaagattaga gagcaagctc ccctattggc gcgttga         2577
//

If you have problems or comments...

PBIL Back to PBIL home page