(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE463

CP002209.PE463       Location/Qualifiers
FT   CDS_pept        complement(513389..514363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0463"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959: IPR011704: IPR003593: IPR003960; KEGG:
FT                   she:Shewmr4_2522 ATPase central domain-containing protein;
FT                   PFAM: AAA ATPase central domain protein; ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase;
FT                   SPTR: A3JBI6 Putative ATPase; PFAM: ATPase family
FT                   associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74677"
FT                   /db_xref="GOA:E1SP28"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP28"
FT                   /protein_id="ADN74677.1"
FT                   /translation="MAKSDKIISLVKAGALGDKQQFKRVTESLIADERAKKHHVIAERL
FT                   EDALRTISVSNATLRPRDYGFSKIASLVDERHPAIKLSELVLNPSITESINELIAEQSR
FT                   ADLLRSYSLEPRNRLLLIGPPGNGKTSIAEALAEALMVPLIVVRYEGVIGSYLGETASN
FT                   LKKVIEFASSRRCVLFFDEFDTLGKERGDTHDTGEVKRVVSSLLMQIDSLPSHVVVVGA
FT                   TNHSELLDRAVWRRFQIRLEVPMPTRSQISKWFSDFEQHHGISLGYAPETLAKKLSGAN
FT                   FSEVKEFGTTVLRKMVLSLPDANMKDICAETVKNWHKVTYKNN"
     atggcaaagt ccgataaaat cataagcttg gtaaaagcag gcgcactagg cgataagcag        60
     cagttcaagc gcgtaacaga atccttgatc gcagatgagc gggccaagaa gcatcatgtg       120
     atagctgagc gcttggaaga tgcactcaga acaataagtg tatccaacgc aactctaaga       180
     cccagagact acggcttttc taaaattgcc tccttggtgg atgagcggca ccctgccatc       240
     aagctgtccg aactagtctt aaacccttca attacagagt cgattaatga gttaatcgca       300
     gagcagtctc gggctgattt gcttcgctca tacagcttgg agccgagaaa tcgactccta       360
     cttatcggcc ccccaggtaa tggcaaaact tccattgcag aagctttggc tgaagcgtta       420
     atggtgccgt tgattgtagt cagatatgaa ggtgtaatcg gttcttattt gggagagacc       480
     gcctctaacc taaagaaggt tattgaattt gcctcatcta gacgttgcgt cttgtttttt       540
     gacgagtttg atacattagg aaaagaacgt ggtgacactc acgatacagg tgaagtaaag       600
     agggttgtta gctcactatt aatgcagatt gactctttac catctcatgt tgttgtagtt       660
     ggtgcgacaa accattctga gctattggat cgtgctgtat ggcggcgctt ccaaattaga       720
     ctggaagtac caatgccaac tagatcacaa atttcaaagt ggttctccga ctttgaacag       780
     catcatggta tttcactagg gtatgcacct gagacattgg caaaaaaact atcaggagct       840
     aatttctcag aagtaaaaga gtttgggact actgtactta gaaaaatggt cctcagcttg       900
     cctgatgcca atatgaaaga catttgtgca gaaaccgtta agaactggca taaagtgacc       960
     tacaagaaca actaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page