(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE467

CP002209.PE467       Location/Qualifiers
FT   CDS_pept        complement(517540..518787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0467"
FT                   /product="integrase family protein"
FT                   /note="InterPro IPR002104; KEGG: spc:Sputcn32_3540 phage
FT                   integrase family protein; PFAM: integrase family protein;
FT                   SPTR: A3ENU8 Site-specific recombinase, phage integrase
FT                   family protein (Fragment); PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74681"
FT                   /db_xref="GOA:E1SP32"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP32"
FT                   /protein_id="ADN74681.1"
FT                   /translation="MALNAKQIENLKPKDKSFAIADQNGLSLRIRPSGAKSWIYRFRYG
FT                   GKADTLTLGSYPLMSLKQARMRTVQLASELENGTSPREYIRQEKLEAQRKGYTVTALWE
FT                   EFDQIKISKRQRPEQPRYLAVKYILPIIGKIPCANLGKADVLEIFRPLEKTPGACESVF
FT                   SLVKLLLTFGVNRGEVRSDAIFGLRAKDVGGSSNKRDRNLAFAEIRQLLTIIEKSGTSP
FT                   TYKNAITMTLASGQRISTVLSARWSEFDMAARIWTIPASSEERYTKSKKSRKLPLSDFM
FT                   VSILEHQRQYVPARWKCVFPKQKSDEPPVNTSVNAVIRQMLKCHNDDGKEKLEHFHPHA
FT                   LRDTFVSRLAELGQPYDIVERTVGHAIAGTRAHYLHYDFFNEQLALLELWGNKLRELST
FT                   DNVVTIEERKDFQHTQ"
     atggcactta acgctaagca gatagagaac ctaaagccca aggacaaaag ctttgccatc        60
     gccgaccaga acgggttatc cctccgtatc aggcccagtg gcgcgaagag ctggatctac       120
     cgatttaggt atggtgggaa ggctgacacc ttaacgctag gcagttaccc actaatgagc       180
     ctaaagcagg ccaggatgag aacggtccaa ctggccagtg agctggaaaa tggcacaagt       240
     ccccgcgaat acatcagaca agaaaagtta gaagcgcagc gtaaggggta taccgtaacc       300
     gcgctgtggg aagaatttga ccagataaag atcagtaagc gacagcgacc tgagcaacct       360
     cgatacctag cagttaagta catcctgcca atcattggaa agatcccctg tgcaaacctg       420
     ggtaaagccg acgtacttga gatattccga cccctggaga aaaccccggg agcctgcgag       480
     agtgtgttct ctctcgtaaa gctgctgcta acctttggtg tcaaccgagg agaggttcgc       540
     tcagacgcga tctttgggct tcgagctaag gatgttggcg ggagtagcaa caagcgtgat       600
     cgcaacctgg cgttcgctga gatcagacaa ctcctgacta tcatcgagaa atccggaacc       660
     agtccgacat ataaaaacgc tattaccatg acgctagcca gcggccagag gatctccacg       720
     gtactcagcg cccgatggtc agagttcgat atggcagcca ggatatggac aattcctgcc       780
     tctagtgaag aacgatacac caagagcaag aaatccagaa agctcccctt atccgacttc       840
     atggtcagca tccttgagca ccagcgacag tatgtgcctg cacgttggaa gtgcgttttt       900
     ccaaaacaga agagcgatga gcctccggtc aacacctccg ttaacgctgt gatccggcaa       960
     atgttgaagt gccacaacga cgacggcaaa gagaagctag agcactttca ccctcatgct      1020
     cttcgggaca ctttcgttag ccgattagcg gagttaggcc agccatacga catcgtagag      1080
     cggacagtgg ggcacgccat cgcaggtact agggcgcact acctacacta cgactttttc      1140
     aatgagcagc tagccctgct agagctgtgg ggcaataagc tgcgagagct ttcgaccgac      1200
     aacgtcgtaa ccatcgaaga acgaaaagat ttccaacata cacaatga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page