(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE468

CP002209.PE468       Location/Qualifiers
FT   CDS_pept        complement(518936..520285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0468"
FT                   /product="biotin carboxylase ;acetyl-CoA carboxylase
FT                   carboxyltransferase subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0439 Biotin carboxylase; InterPro
FT                   IPR005482: IPR005479: IPR020561: IPR005481: IPR 011761:
FT                   IPR011764: IPR004549; KEGG: ilo:IL2286 acetyl-CoA
FT                   carboxylase biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding; biotin
FT                   carboxylase domain protein; Phosphoribosylglycinamide
FT                   synthetase, ATP-grasp (A) domain; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; SPTR: A3WLT1
FT                   Acetyl-CoA carboxylase; TIGRFAM: acetyl-CoA carboxylase,
FT                   biotin carboxylase; PFAM: Carbamoyl-phosphate synthase L
FT                   chain, ATP binding domain; Biotin carboxylase C-terminal
FT                   domain; Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA carboxylase, biotin
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74682"
FT                   /db_xref="GOA:E1SP33"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP33"
FT                   /protein_id="ADN74682.1"
FT                   /translation="MLDKVVIANRGEIALRILRACRELGIKTVAVHSTADRELKHVLLA
FT                   DETICIGNAPATESYLNIPAIIAAAEVTDAIAIHPGYGFLAENADFAEQVENSGFIFIG
FT                   PTADVIRLMGDKVSAINSMKKAGVPCVPGSDGPLTEDNTRNIQIAKRIGYPVIIKAAGG
FT                   GGGRGMRVVRSEAELLKSIELTKAEAGAAFGNDTVYMEKFLENPRHIEVQVLADGQGSA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEEMRKFIGERCAKACVEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMVTGVDLIKEQLRIAAGQPLSISQEQVVIRGHAIECRIN
FT                   AEDPKNFIPSPGTITHFHPPGGMGIRWDSHIYAGYRVPPYYDSMIGKLITYGENRGIAI
FT                   ARMRNALHELVVDGIKTNVPLQQRIMADENFQNGGTNIHYLEKKLDQESS"
     atgttggata aagtggtgat cgccaaccgc ggcgaaattg ccttgcgcat cctccgcgct        60
     tgtcgcgaac tggggatcaa aaccgtagcg gtgcactcca ccgccgaccg cgagctgaag       120
     cacgtactgc tggccgatga gaccatctgc atcggcaacg ctccggccac cgaaagttac       180
     ctcaacatcc cggcgatcat cgccgccgct gaggtgactg acgccatcgc catccacccg       240
     ggctacggct tcctggcgga aaacgccgac tttgccgagc aggtggagaa cagcggattc       300
     atctttatcg gtcccaccgc cgatgtgatc cgcctgatgg gcgacaaggt gtccgccatc       360
     aactccatga agaaagccgg tgtgccctgc gtaccgggtt ccgatggccc gctgaccgaa       420
     gacaacaccc gtaacatcca gattgccaag cgcatcggtt acccggtgat catcaaggcc       480
     gccggtggcg gtggtggtcg cggcatgcgt gtggttcgca gcgaagcgga actgctcaag       540
     tccatcgagc tgaccaaggc ggaagccggt gccgcgttcg gcaacgacac cgtctacatg       600
     gagaaattcc tcgagaaccc gcgccacatt gaggtgcagg tactggctga cggtcagggc       660
     agcgccatcc acctgggtga gcgtgattgc tccatgcagc gtcgccacca gaaagtggtt       720
     gaggaagccc cggctccggg catcaccgaa gagatgcgta agttcatcgg tgagcgctgt       780
     gccaaagcct gtgttgagat cggctaccgt ggtgccggta ccttcgagtt cctgtacgaa       840
     aacggcgagt tctactttat cgagatgaac acccgtatcc aggttgagca ccccgttacc       900
     gagatggtga ccggcgttga cctgattaag gaacagctgc gtatcgcggc cggccaaccg       960
     ctctccatca gtcaggagca ggtggtgatt cgtggtcacg ccattgagtg ccgcatcaac      1020
     gcggaagacc cgaaaaactt catcccgtcc ccgggtacca tcacccattt ccacccgccg      1080
     ggtggcatgg gcatccgctg ggacagccac atctacgctg gctaccgggt accgccctac      1140
     tacgactcca tgattggcaa gctgatcacc tacggtgaaa accgtggcat cgccatcgcc      1200
     cgcatgcgca acgcgctgca cgagctggtg gtggacggca tcaaaaccaa cgtgccgctg      1260
     cagcagcgca tcatggccga cgagaacttc cagaacggtg gcaccaacat ccactatctg      1320
     gagaagaagc tcgatcaaga atctagctag                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page