(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE472

CP002209.PE472       Location/Qualifiers
FT   CDS_pept        complement(521855..522262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2057)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74686"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP37"
FT                   /protein_id="ADN74686.1"
FT                   /translation="MKARYWPLMALFCPLAMAGELHLPEGFYATAVNGQAVSPHQNRLN
FT                   LGSGRQVVTLRYANPYLFHKEFHEVLVSAPLYLVFDASNQHYRISATLPTELEAARRFA
FT                   RDPEFSLTSQQQPIPYQTYRYNQAVNALLSR"
     atgaaagcac gctactggcc cctgatggcc ctgttctgcc ccctggcaat ggccggtgaa        60
     cttcacctgc cggaagggtt ctacgccact gccgtcaatg gtcaggcggt ctccccccat       120
     caaaaccggc tgaacctggg ctcaggtcgt caggtggtaa cactgcggta cgccaacccc       180
     tacctgttcc ataaagagtt ccacgaagtg ctggtgtccg ccccgctgta tctggttttt       240
     gatgccagca accagcatta ccgcatcagc gccacactcc ccactgagct ggaagcggcg       300
     cgccgctttg cccgcgaccc agagttcagc ctgaccagtc agcagcaacc catcccttac       360
     cagacctacc gttacaatca ggcggtgaat gccctgctga gccgctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page