(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE474

CP002209.PE474       Location/Qualifiers
FT   CDS_pept        523237..524271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4075 hypothetical protein; SPTR:
FT                   A0Y741 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74688"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP39"
FT                   /protein_id="ADN74688.1"
FT                   /translation="MLQLVVGPEARRQISQSGLQPELFDKVIAASGGPKWIPLAALDRH
FT                   LLYQFFPAEQPLSLLGTSSGAWRCTTLSNPGSDAAHRRLQHAYIHQRYDRPPMPAEVDA
FT                   MCEGILSDALGECAPAICDNLYRQLNIIVCRGRHLNDSARRGSQLAGLAFTALTNLARR
FT                   RSLSMSWQRLVASTGLDTPFVPMDDLPTEAAPLDANNLLPVMLASGSIPLVLSGVTGIP
FT                   GLPPGRYFDGGVTDYHLDLPALQRGGLTLYPHFYPHAAPGWFDKKLPWRRASTNFDKVA
FT                   ILTPDPTFIARLPRGRLPDRSDFKTLDSDRRIRDWERAAELGEALVDTFQKLVQDPMPY
FT                   LRSL"
     atgttacaac tggtggtggg gccggaggcc cggcgacaga ttagccagtc gggtttgcag        60
     cccgaactgt tcgataaagt gattgcggcc agtggtggcc ccaagtggat cccactggca       120
     gcgctcgacc gtcacctgct gtatcagttc ttccctgccg aacaaccgtt gtccctgttg       180
     ggcacctcct ccggggcgtg gcgttgcacc accctgtcca atcccggcag cgatgccgcc       240
     catcgtcgcc tgcaacacgc ctatatccat cagcgctatg accggccgcc gatgccggcg       300
     gaagtggatg ccatgtgtga ggggatactc tctgatgcgc tgggggagtg tgctccggcg       360
     atctgtgaca atctctaccg tcagctcaat atcattgttt gtcgtggccg ccacctgaat       420
     gacagcgccc gtcgtggcag ccaactggcg gggctggcct ttaccgcgct gaccaatctg       480
     gcccgtcgcc ggagcctgtc gatgtcgtgg cagcggctgg tggccagcac cgggttggat       540
     acgccttttg tgccgatgga tgacctgccc acggaggcgg cccctctgga tgccaataac       600
     ctgctgccgg tgatgctggc cagtggcagc attcctctgg tgttatccgg tgtaaccggg       660
     atccctgggc tgccccccgg ccgctacttt gacggcggtg tgaccgacta ccatctggac       720
     ctgccagctt tgcaacgcgg tggcctgacc ctataccccc acttctaccc tcatgcggcg       780
     ccgggctggt ttgataagaa gttgccctgg cgccgggcca gcaccaactt cgacaaggtg       840
     gcgatcctga cacccgatcc cacctttatt gcccgtctgc cccgcgggcg gctgccggac       900
     cggagtgact ttaagactct ggacagcgat cgtcggatcc gtgactggga gcgcgcggcg       960
     gaactgggtg aagccttggt ggataccttt cagaagttgg tgcaggaccc gatgccctac      1020
     ttacgttcgc tttaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page