(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE48

CP002209.PE48        Location/Qualifiers
FT   CDS_pept        complement(60479..61228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74262"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA8"
FT                   /protein_id="ADN74262.1"
FT                   /translation="MLRTITVFTAGALAGGLTGALVAHHWLTPQPPVCPPQVPCNADAD
FT                   ELAMLQWENRMLVAMVQAGLRGDISGHIQTFSAMQAPPKTNPTATPQPVTSPAAPAQPP
FT                   TGAAADALVERLTRADLKLQRQALAEGWATDERLVRERQALWDQARRQLSDHDYMNALH
FT                   RAGRPNRLLVDAVKRDIKGLQHGDVIWALDGRRILTRAEYRDYLATLPEQTLVTVEIRR
FT                   NGQSQQLSVSGLASGLSLIADSVPAPE"
     atgctgcgaa ccatcactgt ttttaccgcc ggcgctctgg ccgggggcct caccggagca        60
     ctggtggccc accattggct gaccccgcag ccgccggtct gcccgcctca ggttccctgc       120
     aatgccgatg cggatgaact ggcgatgctg cagtgggaaa accgcatgct ggtggccatg       180
     gtgcaggccg gactccgcgg cgacatctcc gggcatatcc agaccttcag cgccatgcag       240
     gcgccgccaa aaaccaaccc cactgcaacg ccccaacccg tcacaagccc tgctgcaccc       300
     gcacagccgc ccactggagc cgccgccgat gcactggtcg agcgcctgac ccgggccgat       360
     ctgaaactgc agcgccaggc actggctgag ggctgggcca ccgatgagcg cttggtccgt       420
     gaacgccagg ccctgtggga tcaggcccgc cgccagctct cggaccacga ctacatgaac       480
     gccctgcacc gggcaggccg ccccaaccgc ctgctggtgg atgcggtaaa acgggacatc       540
     aaggggttgc agcatgggga tgtgatctgg gcgctggatg gccgacggat cctcacccgg       600
     gccgaatacc gcgattatct ggccacgctg ccggagcaga cgctggtcac cgtggagatc       660
     cgccgcaacg gccaaagcca gcagctttcg gtcagcggcc tggccagcgg actctcgctg       720
     attgccgatt ccgtccctgc gcctgagtag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page