(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE481

CP002209.PE481       Location/Qualifiers
FT   CDS_pept        complement(530735..531082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0481"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COGs: COG1324 conserved hypothetical protein
FT                   involved in tolerance to divalent cations; InterPro
FT                   IPR004323; KEGG: aha:AHA_0786 divalent-cation tolerance
FT                   protein CutA; PFAM: CutA1 divalent ion tolerance protein;
FT                   SPTR: B1JMR6 Divalent-cation tolerance protein cutA; PFAM:
FT                   CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74695"
FT                   /db_xref="GOA:E1SP46"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP46"
FT                   /protein_id="ADN74695.1"
FT                   /translation="MLSSAQTDPTNDHRVVLCTCPDNASAERVADALLSQKLVACVNLL
FT                   PGITSLYHWKGELCRDNEVQLVLKTRASCLPALETCIRAHHPYEVPEILALPVEWGHRP
FT                   YLEWINQHCQP"
     gtgttgtctt cagctcaaac tgacccaacc aacgaccatc gggtcgtgct ctgcacctgc        60
     ccggataacg ccagcgccga gcgcgtggcg gacgcgttgt tgagccagaa gctggtggcc       120
     tgcgtaaacc tgctgccggg catcacttcg ctctaccatt ggaagggcga actgtgccgc       180
     gacaacgagg tgcaacttgt gctgaaaacc cgggcatcgt gcctgccagc attggaaacc       240
     tgcatccggg ctcaccaccc gtacgaggtt cccgagatcc tggccctgcc cgttgaatgg       300
     ggccaccgcc cctatttgga atggattaac caacactgcc agccatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page