(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE484

CP002209.PE484       Location/Qualifiers
FT   CDS_pept        533336..533626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0484"
FT                   /product="chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR001476: IPR018369; KEGG: eum:ECUMN_4677 co-chaperonin
FT                   GroES; PFAM: chaperonin Cpn10; SPTR: Q3YUJ8 10 kDa
FT                   chaperonin; PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74698"
FT                   /db_xref="GOA:E1SP49"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP49"
FT                   /protein_id="ADN74698.1"
FT                   /translation="MNIRPLHDRVIVKRTEVETKSAGGIVLTGSAAEKSTRGEVLAVGN
FT                   GRILENGEVKALDVKVGDTVIFNEGYGVKTEKVDGQEVLIMSESDILAIVE"
     atgaacatcc gtccgttgca tgatcgtgta atcgttaagc gtactgaagt ggaaaccaag        60
     tccgctggtg gcatcgtcct gactggtagc gccgcggaga aatccacccg tggtgaagtg       120
     ctggccgtag gcaatggccg catcttggaa aacggtgaag tgaaagccct ggacgtgaag       180
     gttggcgata ccgtcatctt caacgaaggc tacggcgtga agactgaaaa agtggatggt       240
     caggaagtgc tgatcatgtc cgagtccgac atcctggcga tcgtcgaata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page